Align ABC-type transporter, integral membrane subunit, component of Trehalose porter. Also binds sucrose (Boucher and Noll, 2011). Induced by glucose and trehalose. Directly regulated by trehalose-responsive regulator TreR (characterized)
to candidate HSERO_RS22745 HSERO_RS22745 sugar ABC transporter permease
Query= TCDB::G4FGN6 (278 letters) >FitnessBrowser__HerbieS:HSERO_RS22745 Length = 300 Score = 140 bits (353), Expect = 3e-38 Identities = 87/281 (30%), Positives = 142/281 (50%), Gaps = 7/281 (2%) Query: 1 MSRSITQRILLYIAVVLIL--IWCVFPLYWAFISSIKPDRDLFEKNPSLFP--KRITFEN 56 + RS Q L++ VL L + +FP+ I+S+K +FE P P + +TF Sbjct: 23 IQRSFGQAGHLWVHTVLCLYAVIALFPIALILINSVKTRNAIFE-GPMALPTAETLTFAG 81 Query: 57 YVKVFKERPFHINIKNSIIVAGITTVLALVVGSLAGYAIARLKFRGKVIVMSLILAVSMF 116 + KV F + NS+ V L ++ G++A +A+ +F G + I M Sbjct: 82 FQKVLAGTHFLLYFGNSLAVTVAALFLIVLFGAMAAWALTEYRFFGNRALNFFIAIGIMI 141 Query: 117 PQVSILGSLFLILRGLKLINTYTGLIIPYTAMNLPLTVWVLQSFFRELPKEVEESAFIDG 176 P S+ ++ L LINT T L++ YTA LPL V +L F R++P E++++A DG Sbjct: 142 PIRLGTVSILQLVVALDLINTRTALVLVYTAQGLPLAVMILSEFMRQIPGELKDAARCDG 201 Query: 177 ASKLRTLWSIVLPMSAPGLVATGLLTFIAAWNEFLFALTFMQKPSLYTVPVAVALFKGAS 236 +L + ++LP+ P + + T I AWN+ F L TV + V F G Sbjct: 202 VGELSIFFRVILPLLRPAIATVAVFTMIPAWNDLWFPLILAPGEDTRTVTLGVQQFIG-- 259 Query: 237 QYEIPWGQLMAAAVIVTLPLVILVLVFQNRIIAGLSAGAVK 277 QY W ++AA + +P+++L + F ++I GL++GAVK Sbjct: 260 QYATDWNSVLAALSMAVIPVLLLYMAFSRQLIRGLTSGAVK 300 Lambda K H 0.329 0.142 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 300 Length adjustment: 26 Effective length of query: 252 Effective length of database: 274 Effective search space: 69048 Effective search space used: 69048 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory