Align catechol 1,2-dioxygenase (EC 1.13.11.1) (characterized)
to candidate HSERO_RS18295 HSERO_RS18295 3'-RNA processing protein
Query= BRENDA::Q8GAZ6 (300 letters) >FitnessBrowser__HerbieS:HSERO_RS18295 Length = 303 Score = 396 bits (1018), Expect = e-115 Identities = 190/300 (63%), Positives = 236/300 (78%), Gaps = 1/300 (0%) Query: 1 MDIKTIDALLNKINESATHEGNARTKQVVNRIIRDLFITIDELDVTPNEFWSALNYLGEA 60 +D K IDA+L KI + EGN R K VVNR++RD+F TI+ELDV P EFW+A++YL A Sbjct: 1 VDKKAIDAVLQKIESTELAEGNQRVKTVVNRLVRDMFYTIEELDVQPEEFWAAVDYLTSA 60 Query: 61 GQSGELGLLAAGLGFEHFLDVRLDEAEAKAGLQGGTPRTIEGPLYVAGAPESTGHARLDN 120 G+SGE GL+AAGLGFEHFLD+R+DEAEA+ G+QGGTPRTIEGPLYV+GAPE G AR+D Sbjct: 61 GKSGEFGLIAAGLGFEHFLDLRMDEAEARRGVQGGTPRTIEGPLYVSGAPEQKGFARMDK 120 Query: 121 GNEPGETLVMRGRVLAENGEPVRDALVEVWHANHLGNYSHFDKSQAEFNLRRSIRTDENG 180 +PG+TL M+G+V E+G+P+ +ALVEVWHANHLG YS FD Q+ FNLR SIRTDE G Sbjct: 121 DPQPGDTLFMQGQVFDEHGKPLANALVEVWHANHLGRYSFFDPDQSPFNLRCSIRTDEQG 180 Query: 181 TYSFRSVVPIGYSVPPQGKTQQLLDLLGRHGHRPAHIHFFVSAPGYRKLTTQINIEGDPY 240 Y FRS VP+GYSVPP G T +LL LGRHG RPAHIHFFV+ PGYRKLTTQINI GDPY Sbjct: 181 RYRFRSRVPVGYSVPPGGATDRLLTKLGRHGSRPAHIHFFVTVPGYRKLTTQINIAGDPY 240 Query: 241 LWDDFAFATREGLVPAVKK-EEGATGKPYGIDGQFALIDFDFSLVKDRDNVPTSEVERVR 299 LWDDFAFATREGLVP +K + A + + +D F I+F+F+L+ ++ ++P +++ R R Sbjct: 241 LWDDFAFATREGLVPELKHVTDPAEIRKHEVDAPFYAIEFNFNLLPEQADLPKADINRPR 300 Lambda K H 0.317 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 333 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 303 Length adjustment: 27 Effective length of query: 273 Effective length of database: 276 Effective search space: 75348 Effective search space used: 75348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS18295 HSERO_RS18295 (3'-RNA processing protein)
to HMM TIGR02439 (catA: catechol 1,2-dioxygenase (EC 1.13.11.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02439.hmm # target sequence database: /tmp/gapView.13209.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02439 [M=285] Accession: TIGR02439 Description: catechol_proteo: catechol 1,2-dioxygenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-137 441.3 0.0 6.7e-137 441.1 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS18295 HSERO_RS18295 3'-RNA processing Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS18295 HSERO_RS18295 3'-RNA processing protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.1 0.0 6.7e-137 6.7e-137 2 285 .] 3 284 .. 2 284 .. 0.99 Alignments for each domain: == domain 1 score: 441.1 bits; conditional E-value: 6.7e-137 TIGR02439 2 tkevqallkkvagleqeggnarikqivlrvlsdlfkaiedlditedefwaaveylnklGqanelglla 69 +k ++a+l+k+ ++e ++gn+r+k +v+r+++d+f +ie+ld++++efwaav+yl+++G+++e+gl+a lcl|FitnessBrowser__HerbieS:HSERO_RS18295 3 KKAIDAVLQKIESTELAEGNQRVKTVVNRLVRDMFYTIEELDVQPEEFWAAVDYLTSAGKSGEFGLIA 70 689***************************************************************** PP TIGR02439 70 aGlGlehfldlrldaadakagleggtPrtieGPlyvaGapvseGfarlddgseddkaetlvlkGqvld 137 aGlG+ehfldlr+d+a+a+ g++ggtPrtieGPlyv+Gap+++Gfar+d+++ + ++tl+++Gqv+d lcl|FitnessBrowser__HerbieS:HSERO_RS18295 71 AGLGFEHFLDLRMDEAEARRGVQGGTPRTIEGPLYVSGAPEQKGFARMDKDP--QPGDTLFMQGQVFD 136 ***************************************************9..568*********** PP TIGR02439 138 aeGkpiagakvevwhanskGnysffdksqsefnlrrtiitdaeGkyrarsvvPvGygvppqgptqqll 205 ++Gkp+a+a vevwhan+ G ysffd+ qs+fnlr +i+td++G+yr+rs vPvGy+vpp g+t++ll lcl|FitnessBrowser__HerbieS:HSERO_RS18295 137 EHGKPLANALVEVWHANHLGRYSFFDPDQSPFNLRCSIRTDEQGRYRFRSRVPVGYSVPPGGATDRLL 204 ******************************************************************** PP TIGR02439 206 nllGrhGerPahvhffvsapgyrklttqinlegdkylyddfafatreglvaevkevedaaaakrrgve 273 +lGrhG rPah+hffv+ pgyrklttqin++gd+yl+ddfafatreglv+e+k+v+d a++++++v+ lcl|FitnessBrowser__HerbieS:HSERO_RS18295 205 TKLGRHGSRPAHIHFFVTVPGYRKLTTQINIAGDPYLWDDFAFATREGLVPELKHVTDPAEIRKHEVD 272 ******************************************************************** PP TIGR02439 274 grfaeiefdlel 285 +f ief+++l lcl|FitnessBrowser__HerbieS:HSERO_RS18295 273 APFYAIEFNFNL 284 *********987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (303 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.06 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory