Align 2-aminomuconate deaminase (EC 3.5.99.5) (characterized)
to candidate HSERO_RS06570 HSERO_RS06570 endoribonuclease L-PSP
Query= metacyc::MONOMER-13362 (143 letters) >FitnessBrowser__HerbieS:HSERO_RS06570 Length = 138 Score = 60.5 bits (145), Expect = 1e-14 Identities = 41/115 (35%), Positives = 56/115 (48%), Gaps = 13/115 (11%) Query: 23 RAGDFLFVSGTSSRRPDNTLVGVEVDAMGTTRLDIVAQTTAVIENIRDILGSVGATLDDV 82 R G L+VSG R PD LV AQ EN++ +L + G TLDD+ Sbjct: 26 RVGQVLYVSGQIGRGPDMQLVEPRE-----------AQIVQAFENLKLVLATAGGTLDDI 74 Query: 83 VEISTFLVNMNDFAGYNEVYGTYFG-YEGPTRTTVAVHQL-PHPHLLIEIKAVAY 135 V+++TF +M D + +V Y Y P T + H L P +IEIKAVA+ Sbjct: 75 VDLTTFHTDMRDLPLFIKVRNRYLSHYPLPAWTAIGAHMLGGAPGYVIEIKAVAH 129 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 63 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 143 Length of database: 138 Length adjustment: 15 Effective length of query: 128 Effective length of database: 123 Effective search space: 15744 Effective search space used: 15744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory