Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate HSERO_RS19935 HSERO_RS19935 hydrolase
Query= BRENDA::Q13KT2 (263 letters) >lcl|FitnessBrowser__HerbieS:HSERO_RS19935 HSERO_RS19935 hydrolase Length = 420 Score = 154 bits (388), Expect = 4e-42 Identities = 93/254 (36%), Positives = 126/254 (49%), Gaps = 5/254 (1%) Query: 11 LHYRIDGERHGNAP--WIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGHGHSEAPKG 68 LHY + R+G AP +VLS++LGTDL MW L+ RV+ YD RGHG SE G Sbjct: 164 LHYTVREPRNGKAPRHTVVLSHALGTDLMMWDGLANQLAADCRVIAYDHRGHGSSEKADG 223 Query: 69 PYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVALCNTAARI-- 126 Y++ L D L+ L + GLSMGG+ G LA RH + + L NT + Sbjct: 224 LYSMADLADDAARLLRELDSGPVVWVGLSMGGMVGQELALRHPGLVRALVLANTTSAYPD 283 Query: 127 GSPEVWVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVHTDKEGYASN 186 + E W R R EG+ +ADAV+ R+F + + +A R V TD GY Sbjct: 284 AAREAWQQRIATVRAEGIEVIADAVMGRYFHEGFRSAQAATVARYRQRLVTTDAVGYVGC 343 Query: 187 CEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARY-VELDASHISNI 245 C A+ D I+VP LVI+G D A + L I+GAR V ASH+S + Sbjct: 344 CHAVGTVDTAARLGSIRVPTLVIAGELDQGTPVAMAQALVDGISGARLAVIAGASHVSAV 403 Query: 246 ERADAFTKTVVDFL 259 E+ F + V F+ Sbjct: 404 EQPALFAELVCGFI 417 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 420 Length adjustment: 28 Effective length of query: 235 Effective length of database: 392 Effective search space: 92120 Effective search space used: 92120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS19935 HSERO_RS19935 (hydrolase)
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.32715.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-81 259.1 2.1 2.5e-81 258.7 2.1 1.2 1 lcl|FitnessBrowser__HerbieS:HSERO_RS19935 HSERO_RS19935 hydrolase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS19935 HSERO_RS19935 hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 258.7 2.1 2.5e-81 2.5e-81 2 250 .. 164 417 .. 163 418 .. 0.95 Alignments for each domain: == domain 1 score: 258.7 bits; conditional E-value: 2.5e-81 TIGR02427 2 lhyrlegaeadk...pvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpegpysiedla 66 lhy+++ ++++k ++vl+ LGtdl +wd +++l++d rv++yD+rGHG+S+ +g ys++dla lcl|FitnessBrowser__HerbieS:HSERO_RS19935 164 LHYTVREPRNGKaprHTVVLSHALGTDLMMWDGLANQLAADCRVIAYDHRGHGSSEKADGLYSMADLA 231 89999877765422268*************************************************** PP TIGR02427 67 ddvlallDalgiekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigt..aesWeaRiaavrae 132 dd ++ll +l+ ++ +GlS+GG+++q La+r+p +v+alvl+nt+ + +e W++Ria+vrae lcl|FitnessBrowser__HerbieS:HSERO_RS19935 232 DDAARLLRELDSGPVVWVGLSMGGMVGQELALRHPGLVRALVLANTTSAYPDaaREAWQQRIATVRAE 299 *********************************************998886522699*********** PP TIGR02427 133 GlaaladavlerwFtpafreaepaelelvrnmlveqppegYaatcaAirdadlrerleeiavPtlvia 200 G++++adav+ r+F ++fr+a++a+++ +r+ lv++++ gY+++c+A+ ++d +rl++i+vPtlvia lcl|FitnessBrowser__HerbieS:HSERO_RS19935 300 GIEVIADAVMGRYFHEGFRSAQAATVARYRQRLVTTDAVGYVGCCHAVGTVDTAARLGSIRVPTLVIA 367 ******************************************************************** PP TIGR02427 201 GdeDgstPpelvreiadlvpgarfaeieeaaHlpnleqpeafaallrdfl 250 G+ D+ tP + +++++d ++gar+a+i++a+H++++eqp+ fa+l+ +f+ lcl|FitnessBrowser__HerbieS:HSERO_RS19935 368 GELDQGTPVAMAQALVDGISGARLAVIAGASHVSAVEQPALFAELVCGFI 417 **********************************************9997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (420 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.52 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory