Align 2-hydroxymuconate semialdehyde hydrolase; HMSH; EC 3.7.1.9; 2-hydroxymuconic semialdehyde hydrolase (uncharacterized)
to candidate HSERO_RS08570 HSERO_RS08570 esterase
Query= curated2:P19076 (283 letters) >FitnessBrowser__HerbieS:HSERO_RS08570 Length = 251 Score = 60.8 bits (146), Expect = 3e-14 Identities = 38/104 (36%), Positives = 56/104 (53%), Gaps = 2/104 (1%) Query: 27 GAGFPLMMIHGSGPGVTAWANWRLVMPELAKSRRVIAPDMLGFGYSERPAD-AQYNRDVW 85 G G PL++ HG + AW + L + RVI+ D LG G S++P D A Y++ Sbjct: 17 GEGPPLLLHHGFTSSLEAWRFFGFT-DVLRQHYRVISFDALGHGQSDKPHDSAAYSQHQR 75 Query: 86 VDHAVGVLDALEIEQADLVGNSFGGGIALALAIRHPERVRRLVL 129 A+ VLDA ++E+ G S GG + L + PER+R L+L Sbjct: 76 CRDALAVLDAAQVERTHFFGYSLGGWVGYGLVRQAPERLRSLIL 119 Lambda K H 0.323 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 251 Length adjustment: 25 Effective length of query: 258 Effective length of database: 226 Effective search space: 58308 Effective search space used: 58308 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory