Align 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) (characterized)
to candidate HSERO_RS18800 HSERO_RS18800 4-hydroxyphenylpyruvate dioxygenase
Query= reanno::psRCH2:GFF3449 (361 letters) >FitnessBrowser__HerbieS:HSERO_RS18800 Length = 293 Score = 127 bits (319), Expect = 4e-34 Identities = 91/299 (30%), Positives = 143/299 (47%), Gaps = 30/299 (10%) Query: 4 VNKIEQH----NPIGTDGFEFVEF--TAPNAEGIEQLRTLFTQMGFTETAKHRSKEVWLF 57 +N IE + NP+G DG EF+E+ T P A G + +MGF + +HRS+EV L+ Sbjct: 2 MNTIENNPVPTNPLGIDGIEFIEYATTEPLALG-----AVLERMGFEQVGRHRSREVVLY 56 Query: 58 QQHDINIVLNGSPTGHVHAFAEKHGPSACAMAFRVKNAAQAAAYVESQGAKLVGSHANFG 117 Q ++N+++N T E S A+A RV++A +A V GA + + A Sbjct: 57 TQGEMNVIVNADATAWAGFDHEVQATSLSAIALRVRDANEAYRRVTELGAWAIPTRAGAM 116 Query: 118 ELNIPCVEGIGGSLLYLVDRYGDKSIYDVDFEYIEGRTPNDNAVGLMCIDHLTHNVMRGQ 177 ELNIP V G G S++Y VDRY D SIYDVDF+ +A+ + L V + Sbjct: 117 ELNIPGVHGCGDSIIYFVDRYRDFSIYDVDFKPASQERRQTSALAGLHFFGLVQAVQPDR 176 Query: 178 MDVWSGFYERIANFREIRYFDIEGKLTGLFSRA--MTAPCGKIRIPINESADDKSQIEEF 235 + W FY + F + EG+ G+ + + +PC + I + E I Sbjct: 177 LREWIDFYSTLMGFSVLP----EGQFFGILPKGSLLVSPCRQFYIQLVEPPAGTEDI--- 229 Query: 236 IREYHGEGIQHIALSTDDIYATVRQLRANGVDFMTTPDTYYEKVDTRVAGHGEPTDVLR 294 + E + + L T D+ VRQL+ GV F+ ++ T+++ G T + + Sbjct: 230 ---HWEEELLRLGLGTPDVLQAVRQLQERGVVFV-------DRAPTQISERGALTQLYK 278 Lambda K H 0.320 0.139 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 293 Length adjustment: 28 Effective length of query: 333 Effective length of database: 265 Effective search space: 88245 Effective search space used: 88245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory