Align Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 (characterized)
to candidate HSERO_RS05610 HSERO_RS05610 fumarylacetoacetase
Query= SwissProt::P16930 (419 letters) >FitnessBrowser__HerbieS:HSERO_RS05610 Length = 448 Score = 380 bits (977), Expect = e-110 Identities = 205/427 (48%), Positives = 268/427 (62%), Gaps = 25/427 (5%) Query: 7 AEDSDFPIHNLPYGVFSTRGDPRP-RIGVAIGDQILDLSIIKHL--FTGPVLSKHQDVF- 62 A+ FPI NLPYGVF G R+GVAIGDQILDL + F+G + Q Sbjct: 25 ADGCPFPIQNLPYGVFRRAGSEEDFRVGVAIGDQILDLPAAQSAGAFSGFDEATRQAAHA 84 Query: 63 --NQPTLNSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPAT 120 + LN+ M L A+W R+ L +LL + TEL C + QA A +PA Sbjct: 85 ACSGSRLNALMALTPASWSALRLALSHLLRTASPH---QTELAAC-LVPQAQAEYDVPAA 140 Query: 121 IGDYTDFYSSRQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQM 180 IGDYTDFY+S HAT VG +FR +N L+PN+ +P+GYHGR SS+ VSG RRP+GQ Sbjct: 141 IGDYTDFYTSIHHATTVGKLFRP-DNPLLPNYKWVPIGYHGRVSSIAVSGQQFRRPLGQT 199 Query: 181 KPDDSKPPVYGACKLLDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQ 240 K D+ P +G CK LD ELE+ F+G GN +GEP+P+ +A + +FG+ L+NDWSARD+Q Sbjct: 200 KAPDADAPTFGPCKRLDYELEIGIFIGGGNAMGEPVPMEEAEDKVFGLCLLNDWSARDVQ 259 Query: 241 KWEYVPLGPFLGKSFGTTVSPWVVPMDALMPF--AVPNPKQDPRPLPYLCHDEPY----- 293 WEY PLGPFL KSF +T+SPW+V ++AL P+ + P DP+PLPYL D P Sbjct: 260 AWEYQPLGPFLSKSFASTISPWIVTLEALAPYRCSWSRPDGDPQPLPYL--DAPTLRTQG 317 Query: 294 TFDINLSVNLKGEGMSQAA----TICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASG 349 FD+ L V ++ M QA + SN++ YWT+ Q +THH+VNGCNLRPGD L SG Sbjct: 318 AFDVQLEVLIQTAAMRQAGQPPQRLSLSNYRDAYWTVAQLVTHHTVNGCNLRPGDFLGSG 377 Query: 350 TISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEVIITGYCQGDGY-RIGFGQC 408 T+SGP P+ GS+LEL+ G P+ L +G+ R FL DGD +I+ + DG IGFG+ Sbjct: 378 TLSGPAPDEAGSLLELTTGGKSPLTLASGEKRVFLEDGDTIILRAVARRDGLPLIGFGES 437 Query: 409 AGKVLPA 415 AG VLPA Sbjct: 438 AGTVLPA 444 Lambda K H 0.321 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 621 Number of extensions: 33 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 448 Length adjustment: 32 Effective length of query: 387 Effective length of database: 416 Effective search space: 160992 Effective search space used: 160992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS05610 HSERO_RS05610 (fumarylacetoacetase)
to HMM TIGR01266 (fahA: fumarylacetoacetase (EC 3.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01266.hmm # target sequence database: /tmp/gapView.26274.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01266 [M=420] Accession: TIGR01266 Description: fum_ac_acetase: fumarylacetoacetase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-172 557.7 0.0 9.4e-172 557.5 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS05610 HSERO_RS05610 fumarylacetoacetas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS05610 HSERO_RS05610 fumarylacetoacetase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 557.5 0.0 9.4e-172 9.4e-172 1 419 [. 18 444 .. 18 445 .. 0.94 Alignments for each domain: == domain 1 score: 557.5 bits; conditional E-value: 9.4e-172 TIGR01266 1 sfvavak..nsdfplqnlPyGvfstk.adssrrigvaiGdqildlskiaaaglfegl...alkehqev 62 s+v++a+ ++fp+qnlPyGvf ++ + r+gvaiGdqildl ++++ag f+g + ++++ + lcl|FitnessBrowser__HerbieS:HSERO_RS05610 18 SWVPSANadGCPFPIQNLPYGVFRRAgSEEDFRVGVAIGDQILDLPAAQSAGAFSGFdeaTRQAAHAA 85 899998864689***********8431455679*******************9998755234455567 PP TIGR01266 63 fkestlnaflalgrparkevrerlqkllsesaevlrdnaalrkeallaqaeatmhlPaqiGdytdfys 130 ++s lna++al+ +++ ++r l +ll + + +++ l++qa+a+ +Pa iGdytdfy+ lcl|FitnessBrowser__HerbieS:HSERO_RS05610 86 CSGSRLNALMALTPASWSALRLALSHLLRTASPH----QTELAACLVPQAQAEYDVPAAIGDYTDFYT 149 8999************************954444....5667789*********************** PP TIGR01266 131 sirhatnvGilfrgkdnallPnykhlPvgyhGrassvvvsGtelrrPvGqikadnakePvfgpckkld 198 si+hat vG+lfr +dn+llPnyk++P+gyhGr ss+ vsG + rrP Gq+ka++a+ P+fgpck+ld lcl|FitnessBrowser__HerbieS:HSERO_RS05610 150 SIHHATTVGKLFR-PDNPLLPNYKWVPIGYHGRVSSIAVSGQQFRRPLGQTKAPDADAPTFGPCKRLD 216 *************.****************************************************** PP TIGR01266 199 lelelaffvgtenelGeavpiekaeehifGvvllndwsardiqaweyvPlGPflaksfattvsPwvvs 266 +ele+++f+g +n++Ge+vp+e ae+++fG++llndwsard+qawey+PlGPfl+ksfa+t+sPw+v+ lcl|FitnessBrowser__HerbieS:HSERO_RS05610 217 YELEIGIFIGGGNAMGEPVPMEEAEDKVFGLCLLNDWSARDVQAWEYQPLGPFLSKSFASTISPWIVT 284 ******************************************************************** PP TIGR01266 267 iealePfrvaqlePeqdpkplpylredr..adtafdielevslkteGlae....aavisrsnakslyw 328 +eal P+r + +P++dp+plpyl + afd++lev ++t+ +++ ++++s sn ++ yw lcl|FitnessBrowser__HerbieS:HSERO_RS05610 285 LEALAPYRCSWSRPDGDPQPLPYLDAPTlrTQGAFDVQLEVLIQTAAMRQagqpPQRLSLSNYRDAYW 352 ************************98755599****************9999999************* PP TIGR01266 329 tlkqqlahhsvnGcnlraGdllgsGtisGkeeeafGsllelsakGkkevkladgetrkfledGdevil 396 t++q ++hh+vnGcnlr+Gd+lgsGt+sG+ +++ Gsllel+++Gk ++ la+ge+r fledGd++il lcl|FitnessBrowser__HerbieS:HSERO_RS05610 353 TVAQLVTHHTVNGCNLRPGDFLGSGTLSGPAPDEAGSLLELTTGGKSPLTLASGEKRVFLEDGDTIIL 420 ******************************************************************** PP TIGR01266 397 rgvckkeGvr.vGfGecaGkvlpa 419 r+v++++G +GfGe aG+vlpa lcl|FitnessBrowser__HerbieS:HSERO_RS05610 421 RAVARRDGLPlIGFGESAGTVLPA 444 ********987************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (420 nodes) Target sequences: 1 (448 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 6.66 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory