Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate HSERO_RS20665 HSERO_RS20665 2,3-dehydroadipyl-CoA hydratase
Query= reanno::WCS417:GFF2712 (367 letters) >FitnessBrowser__HerbieS:HSERO_RS20665 Length = 262 Score = 91.3 bits (225), Expect = 3e-23 Identities = 64/204 (31%), Positives = 103/204 (50%), Gaps = 25/204 (12%) Query: 16 QDEVLAEVRNHIGHLTLNRPAGLNAITLNMVRRLASQLKAWADDPQVYAVVLRGAGEKAF 75 +D + A H+ HLTLNRPA NA+ +R + + L +D V VV+ G EKAF Sbjct: 8 EDLLAARHGEHVLHLTLNRPALRNALRNQSLREIVAALARAEEDDSVRVVVISG-NEKAF 66 Query: 76 CAGGDIRSLYDSFKNGDTLHQDFFVEEYALDLAIHHYR------KPVLALMDGFVLGGGM 129 AG D+ + +H+D + LD+ ++R KP+LA ++G+ LG G Sbjct: 67 AAGADLNEM---------IHKDAIATQ--LDVRAQYWRAIARFPKPILAAVNGYALGAGC 115 Query: 130 GLVQGADLRVVTERSRLAMPEVAIGYFPDVGGSYFLPRIPGE-LGIYLGVTGVQIRAADA 188 L+ AD+ + +++ PE+ +G P GG+ L R G+ L + + ++G I A A Sbjct: 116 ELLMHADIAIAARGAKIGQPEINVGTLPGAGGTQRLIRTVGKPLAMKMVLSGEFISADQA 175 Query: 189 LYCGLADWYLESSKLADLDNKLDR 212 L GL +++ D D L+R Sbjct: 176 LQAGLV------AEVVDDDATLER 193 Score = 23.5 bits (49), Expect = 0.007 Identities = 17/59 (28%), Positives = 24/59 (40%) Query: 273 EWALTTAHLMQTRSPLAMAVTLEMLRRGRRLPLEQCFALELHLDRQWFERGDLIEGVRA 331 E L AH + +SPLA+ + E + + L LE E D EG+ A Sbjct: 192 ERTLALAHSIAQKSPLAVRLAKEAMLQSFELGLEAGLLFERKSFSLMAASADRQEGIAA 250 Lambda K H 0.322 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 367 Length of database: 262 Length adjustment: 27 Effective length of query: 340 Effective length of database: 235 Effective search space: 79900 Effective search space used: 79900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory