Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate HSERO_RS15390 HSERO_RS15390 3-hydroxyisobutyrate dehydrogenase
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__HerbieS:HSERO_RS15390 Length = 297 Score = 328 bits (840), Expect = 1e-94 Identities = 172/288 (59%), Positives = 208/288 (72%), Gaps = 2/288 (0%) Query: 3 DIAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVI 62 +I F+GLGNMG PMA NL+KAG V+ DL +V LVE G + ++ A+VVI Sbjct: 4 NIVFIGLGNMGLPMAQNLVKAGFSVSGHDLVKASVDKLVEVGGKTEADSMAAVAKADVVI 63 Query: 63 SMLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVS 122 +MLPA +HVESLYLG+ G+LA LLIDCSTIAPE ARKVA AA A+G +LDAPVS Sbjct: 64 TMLPASRHVESLYLGEAGVLASAKPGTLLIDCSTIAPEAARKVAAAAKARGFEMLDAPVS 123 Query: 123 GGVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILM 182 GG GA AGTL+F+VGG E F A+P L+ MG+ I+HAG+ G+GQ K+CNNMLLGILM Sbjct: 124 GGTNGATAGTLTFMVGGSKEAFEAAQPYLQKMGKAIYHAGESGSGQTVKVCNNMLLGILM 183 Query: 183 AGTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNLYNPWPGVMPQAPASNGYAGGFQVR 242 GT+EA+ LG+ NG+DP VLSE+M +SSG NW L +YNP PGVM APAS GYAGGF V Sbjct: 184 IGTSEAIRLGMANGMDPKVLSEIMSKSSGRNWTLEVYNPCPGVMETAPASKGYAGGFGVD 243 Query: 243 LMNKDLGLALANAQAVQASTPLGALARNLFSLHAQADAEHEGLDFSSI 290 LM KDLGLA+ NA A + PLGA ARNL+ +H+ A LDFSSI Sbjct: 244 LMLKDLGLAVENALATNCAIPLGATARNLYDIHSMNGAGK--LDFSSI 289 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 297 Length adjustment: 26 Effective length of query: 272 Effective length of database: 271 Effective search space: 73712 Effective search space used: 73712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate HSERO_RS15390 HSERO_RS15390 (3-hydroxyisobutyrate dehydrogenase)
to HMM TIGR01692 (mmsB: 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01692.hmm # target sequence database: /tmp/gapView.4332.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01692 [M=288] Accession: TIGR01692 Description: HIBADH: 3-hydroxyisobutyrate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-127 409.9 10.1 3.4e-127 409.7 10.1 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS15390 HSERO_RS15390 3-hydroxyisobutyra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS15390 HSERO_RS15390 3-hydroxyisobutyrate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 409.7 10.1 3.4e-127 3.4e-127 1 287 [. 7 293 .. 7 294 .. 0.99 Alignments for each domain: == domain 1 score: 409.7 bits; conditional E-value: 3.4e-127 TIGR01692 1 fiGlGnmGgpmaanllkaghavrvfdlsakaveelveaGaqaaasaaeaveeadvvitmlPagkhves 68 fiGlGnmG pma+nl+kag++v+ +dl + v++lve G ++ a +++av++advvitmlPa++hves lcl|FitnessBrowser__HerbieS:HSERO_RS15390 7 FIGLGNMGLPMAQNLVKAGFSVSGHDLVKASVDKLVEVGGKTEADSMAAVAKADVVITMLPASRHVES 74 9*************************************99999999999******************* PP TIGR01692 69 vyagdegilakvkkksllidsstidvdsarkvaeeaaakGavfldaPvsGGvggaraGtltfmvGgea 136 +y+g+ g+la +k ++llid+sti++++arkva++a+a+G+ +ldaPvsGG+ ga aGtltfmvGg++ lcl|FitnessBrowser__HerbieS:HSERO_RS15390 75 LYLGEAGVLASAKPGTLLIDCSTIAPEAARKVAAAAKARGFEMLDAPVSGGTNGATAGTLTFMVGGSK 142 ******************************************************************** PP TIGR01692 137 eefaraepvleamgknivhaGdaGaGqaakiCnnlllgismiGvaealalgeklGldpkvlaeilsks 204 e+f++a+p l+ mgk i haG++G+Gq+ k+Cnn+llgi miG++ea+ lg+++G+dpkvl+ei+sks lcl|FitnessBrowser__HerbieS:HSERO_RS15390 143 EAFEAAQPYLQKMGKAIYHAGESGSGQTVKVCNNMLLGILMIGTSEAIRLGMANGMDPKVLSEIMSKS 210 ******************************************************************** PP TIGR01692 205 sGrcWsldtynPvPGvveqaPasngykgGfatalmlkdlglaqeaaksvkasvllGalarelyslfas 272 sGr+W+l+ ynP PGv+e+aPas+gy+gGf+++lmlkdlgla e+a +++ ++lGa+ar+ly +++ lcl|FitnessBrowser__HerbieS:HSERO_RS15390 211 SGRNWTLEVYNPCPGVMETAPASKGYAGGFGVDLMLKDLGLAVENALATNCAIPLGATARNLYDIHSM 278 ******************************************************************** PP TIGR01692 273 kgagkkdfsavikll 287 +gagk+dfs+++++l lcl|FitnessBrowser__HerbieS:HSERO_RS15390 279 NGAGKLDFSSIFNML 293 ************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (288 nodes) Target sequences: 1 (297 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.54 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory