Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate HSERO_RS04855 HSERO_RS04855 ABC transporter permease
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__HerbieS:HSERO_RS04855 Length = 296 Score = 141 bits (355), Expect = 2e-38 Identities = 86/267 (32%), Positives = 142/267 (53%), Gaps = 6/267 (2%) Query: 13 FIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENYWTVLTDEVFWQAMGRT 72 FI P + +A I PL+ + S+ ++ + F+GL+ + V+ D A+ R Sbjct: 12 FILPVFLTVAFSAIIPLMTVVNYSVQ--DIISPEQKVFVGLDWFREVMRDGELHAALLRQ 69 Query: 73 FFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVGLLGQVMFNQK 132 L +QI LG+G+AL + G TL + L +P+ + VVG + Q+ Sbjct: 70 LIFSFCVLLVQIPLGIGLALAMPHKGWKSSATL--VILAMPLLIPWNVVGTIWQIFGRAD 127 Query: 133 FGVVNQLLG--GADINWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLTMVPGEVEEAAR 190 G+ +L G D N+ +P +A+ ++ DVW WTP VAL+ AGL +P +AA+ Sbjct: 128 IGLGGYVLNLLGIDYNYASNPLDAWLTVLLMDVWHWTPLVALLAFAGLRSIPDAYYQAAQ 187 Query: 191 LETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPGSSTEFISLMIQ 250 ++ S+W V RY+QLP + LV ++LR D+ ++ F LT GGPG+ST F+S + Sbjct: 188 IDGASRWAVFRYIQLPKMRGVLVIAVLLRFMDSFMIYTEPFVLTGGGPGNSTTFLSQYLT 247 Query: 251 RVGFRGFDQGLASAQAIILLIITIVLA 277 + FD G A+A ++I +I ++L+ Sbjct: 248 QKAVGQFDLGPAAAFSLIYFLIILLLS 274 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 296 Length adjustment: 26 Effective length of query: 262 Effective length of database: 270 Effective search space: 70740 Effective search space used: 70740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory