Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate HSERO_RS16730 HSERO_RS16730 sugar ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__HerbieS:HSERO_RS16730 Length = 293 Score = 178 bits (451), Expect = 1e-49 Identities = 96/263 (36%), Positives = 155/263 (58%), Gaps = 5/263 (1%) Query: 14 LVLIITVCVFPFYWMVTTSLK--TQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINS 71 L++ + V +FPFYWMV T+ K ++++ P W+ PTL+++++ LF+ L+N+ Sbjct: 31 LLIFLFVLLFPFYWMVITAFKPDNELLSQSGNPFWVIAPTLAHFKKLLFDTQYPAWLLNT 90 Query: 72 LIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLG 131 +I+++ +TF +L V AA+A+ R F+G K + +I P +L +P I LG Sbjct: 91 VIVSVVSTFASLAASVFAAYAIERLRFQGSKQVGLGIFLAYLIPPSILFIPLAAIVFKLG 150 Query: 132 LLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMP 191 L D LIL Y TF +P W++ FR IPY+L+E A ++GA+++ I+ KI LPLA+P Sbjct: 151 LFDTRWALILTYPTFLIPFCTWLLMGYFRSIPYELEECALIDGATRWEILVKIILPLAVP 210 Query: 192 GVAVSAIFSFIFSWNELMFGL-ILTRSEAKTAP-AMAVSFMEGYNLPYGKIMATSTLIVI 249 G+ + IF+F SWNE ++ L ++ SE KT P + +EG +G +MA + L + Sbjct: 211 GLISAGIFAFTLSWNEFIYALTFISSSEVKTVPVGIVTELVEGDVYHWGALMAGALLGSL 270 Query: 250 PVLIFALIASKQLVRGLTMGAVK 272 PV + + V G+T GAVK Sbjct: 271 PVAVVYSFFVEYYVSGMT-GAVK 292 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 293 Length adjustment: 26 Effective length of query: 246 Effective length of database: 267 Effective search space: 65682 Effective search space used: 65682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory