Align SDR family oxidoreductase (characterized, see rationale)
to candidate HSERO_RS12955 HSERO_RS12955 short-chain dehydrogenase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__HerbieS:HSERO_RS12955 Length = 249 Score = 130 bits (327), Expect = 3e-35 Identities = 89/254 (35%), Positives = 131/254 (51%), Gaps = 23/254 (9%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDV---- 63 L GK LIT A+ GIGRA+ LFAR GA +I T + LE++A++ + V Sbjct: 4 LQGKVALITGASAGIGRATALLFARHGAALILTARRQDALEQVAALICAQGGRASVVAGD 63 Query: 64 -----TDDDAIKALVAKVGTVDVLFNCAGYVAAGNIL-ECDDKAWDFSFNLNAKAMFHTI 117 T + + + + G +D+ N AG V A L E + W + + N + F Sbjct: 64 VGEAATHERGVAMALDEFGGLDIAINNAGAVGACKPLAEISPQQWQDTLHANLTSAFLGA 123 Query: 118 RAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCN 177 R +P MLA+ AG+IV +S S G+ AYGA+KA ++GL K +AAD+ QGIR N Sbjct: 124 RCQIPAMLARGAGAIVFTSSFVGSSAGLPGMAAYGAAKAGLMGLVKGIAADYAVQGIRAN 183 Query: 178 AICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDE 237 A+ PG +++ + G + + A M RI + EE+AA AL+LAS Sbjct: 184 ALLPGGVDT------------DMGGDPQQKQWA-AGLHAMKRIAQPEEIAAAALFLASPM 230 Query: 238 SNFTTGSIHMIDGG 251 ++F TG+ DGG Sbjct: 231 ASFVTGTALYADGG 244 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 249 Length adjustment: 24 Effective length of query: 230 Effective length of database: 225 Effective search space: 51750 Effective search space used: 51750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory