Align FAA hydrolase family protein (characterized, see rationale)
to candidate HSERO_RS17860 HSERO_RS17860 5-carboxymethyl-2-hydroxymuconate isomerase
Query= uniprot:A0A2E7P912 (281 letters) >FitnessBrowser__HerbieS:HSERO_RS17860 Length = 227 Score = 115 bits (287), Expect = 1e-30 Identities = 75/213 (35%), Positives = 107/213 (50%), Gaps = 13/213 (6%) Query: 63 IGACVGNIGKFICIGLNYADHAAE-SNLPIPAEPVVFNKWTSAVVGPNDDVKIPRGSKKT 121 +G + + C+G NYA HA E + P P F K AVV + V P + Sbjct: 16 VGGAAFPVRRIYCVGRNYAAHAREMGHDPDREPPFFFMKPADAVVPTDSVVPYPVATSDY 75 Query: 122 DWEVELGVVIGKGGSYIDEKDAMSHVAGYCVVNDVSEREYQIER---GGTWDKGKGCDTF 178 E+EL V + KGG I + A+ V GY V D++ R+ Q + G WD KG D Sbjct: 76 HHEIELVVALAKGGRNIPVEQALELVFGYAVGLDMTRRDIQSQAKKLGRPWDMAKGFDQS 135 Query: 179 GPIGPWLVTRDEVADPQKLGMWLEVDGKRYQNGNTSTMIFGVAHIVSYLSRFMSLQPGDV 238 P P +V + P + +WL+V+G+ Q G+ + +I+ VA +SYLS + L PGD+ Sbjct: 136 APCAP-IVPVAQAGHPDQGAVWLKVNGEVRQQGDLADLIWSVAETISYLSGLVELFPGDL 194 Query: 239 ISTGTPPGVGMGVKPEAVYLRAGQTMRLGIDGL 271 I TGTP GVG VK G ++ +DGL Sbjct: 195 IFTGTPEGVGAVVK--------GDKLQGHVDGL 219 Lambda K H 0.316 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 227 Length adjustment: 24 Effective length of query: 257 Effective length of database: 203 Effective search space: 52171 Effective search space used: 52171 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory