Align AraV, component of Arabinose, fructose, xylose porter (characterized)
to candidate HSERO_RS22645 HSERO_RS22645 lipase
Query= TCDB::Q97UF2 (371 letters) >FitnessBrowser__HerbieS:HSERO_RS22645 Length = 362 Score = 201 bits (511), Expect = 3e-56 Identities = 114/281 (40%), Positives = 166/281 (59%), Gaps = 3/281 (1%) Query: 1 MTTIRVENLSKIFKKGKTEVKAVDNVSITIDSGMAFGVLGPSGHGKTTFLRLIAGLEEPT 60 MT + V +L + G + VS+ + G +LGPSG GKTT LR +AGLE P Sbjct: 1 MTELSVNDLHLDYGTGAHANPILKGVSMELQRGEVVALLGPSGSGKTTLLRAVAGLESPK 60 Query: 61 SGYIYFDNEAV-SSPRRVMMSPEKRGIAMVFQNWALYPNMTVFDNIAFPLKLAKVPKDKI 119 +G I V R M E+R + +VFQ++AL+P+ TV DN+A+ LKL K P +I Sbjct: 61 AGAIDIGKRRVFDGARNFEMPAEERNLGLVFQSYALWPHKTVADNVAYGLKLRKTPSGEI 120 Query: 120 ENKVKEVSEELGLSGVLNRYPKELSGGQMQRTAIARALVKDPKVLLLDEPFSNLDAQIRE 179 +VK V +LGL + RYP +LSGGQ QR AIARALV +P+V+LLDEP SNLDA++RE Sbjct: 121 ATRVKAVLSQLGLGHLGERYPHQLSGGQQQRVAIARALVYNPQVILLDEPLSNLDAKLRE 180 Query: 180 SARALVRKIQRERKLTTLIVSHDPADIFAIANKAGVIVNGKFAQIGTPTEIYEYPATDLI 239 ARA +R++ L+ L+V+HD + AI+++ ++ NG+ Q GTP +Y+ P T Sbjct: 181 EARAFLRELIVRLGLSALMVTHDQGEAMAISDRILLLNNGRIEQQGTPQSMYQAPNTLFT 240 Query: 240 ARLTGEINLIQAKII--ENNAIIANLKVPLNNMELKGQSNI 278 A G N + A+++ E + L L+G+S++ Sbjct: 241 AEFMGSNNKLAAEVLSREGERVTVKLDGGTAVATLRGRSDV 281 Lambda K H 0.317 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 362 Length adjustment: 30 Effective length of query: 341 Effective length of database: 332 Effective search space: 113212 Effective search space used: 113212 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory