Align Probable 2-keto-3-deoxyxylonate dehydratase; KDXD; EC 4.2.1.141 (characterized)
to candidate HSERO_RS06355 HSERO_RS06355 ureidoglycolate lyase
Query= SwissProt::D4GP28 (289 letters) >FitnessBrowser__HerbieS:HSERO_RS06355 Length = 281 Score = 65.9 bits (159), Expect = 1e-15 Identities = 59/184 (32%), Positives = 89/184 (48%), Gaps = 23/184 (12%) Query: 114 PEVFFKATPSRTVEPGDAIGVRGDSEWDVPEPELGIVLRRG-----------EIVGYTVG 162 P VF K T S V P D + + S+ E ELG+++ +G + GY V Sbjct: 95 PVVFNKWT-SAVVGPNDNVKIPRGSKKTDWEVELGVIIGKGGSYIDEKDAMSHVAGYCVV 153 Query: 163 NDVSSRSIEGENPLYLPQAKVYDRCCSIGPCVVTPEDVEDPHELEMSMTIERDGEVIYDD 222 NDVS R + E + K D IGP +VT ++V DP +L M +E DG+ + Sbjct: 154 NDVSEREYQIERGGTWDKGKGCDTFGPIGPWLVTRDEVADPQKL--GMWLEVDGKRYQNG 211 Query: 223 ATNTSEMVRSCDELVSYFTRHNTVPELAVILTGT------SLVPEQPFDLQEGDHVDITI 276 NTS M+ + +VSY +R ++ VI TGT + PE + L+ G + + I Sbjct: 212 --NTSTMIFNVAHIVSYLSRFMSLQPGDVISTGTPPGVGMGVKPEAVY-LRAGQTIRLGI 268 Query: 277 EGIG 280 +G+G Sbjct: 269 DGLG 272 Lambda K H 0.314 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 289 Length of database: 281 Length adjustment: 26 Effective length of query: 263 Effective length of database: 255 Effective search space: 67065 Effective search space used: 67065 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory