Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate HSERO_RS17235 HSERO_RS17235 3-ketoacyl-ACP reductase
Query= BRENDA::B8H1Z0 (248 letters) >FitnessBrowser__HerbieS:HSERO_RS17235 Length = 261 Score = 132 bits (333), Expect = 5e-36 Identities = 79/247 (31%), Positives = 129/247 (52%), Gaps = 18/247 (7%) Query: 8 SLKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRC 67 +LK ++V++T G GIG +TA F GA V D++++ + A +P+ Y R Sbjct: 4 NLKDQKVIVTAGAQGIGLAITAAFVEAGAHVHICDVSEDFLASARARFGHAPVS--YSRT 61 Query: 68 DLMNLEAIKAVFAEI-----GDVDVLVNNAG-NDDRHKLADVTGAYWDERINVNLRHMLF 121 D+ + + A+FA++ G +DVL+NNAG + +V + WD+ + VNL Sbjct: 62 DVSSEREVDAMFADLAQRWSGRLDVLINNAGIAGPTSPVEEVALSDWDQTLAVNLTGPFL 121 Query: 122 CTQAVAPGMKKRGGGAVINFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDIRV 181 CT+ P +KK GGGA++N S++ LG Y +K G+ G+T A ELGP IRV Sbjct: 122 CTRRAVPLLKKNGGGAIVNISSVAGRLGFALRTPYSASKYGVIGLTETWAIELGPSHIRV 181 Query: 182 TCVVPGNVKTKRQEKWYTPEGEA----------QIVAAQCLKGRIVPENVAALVLFLASD 231 V+PG V+ RQE+ + A ++++ L+ + E++A V+FL S Sbjct: 182 NAVLPGIVEGARQERIVAAKAAAYGIGHEEMRQRLLSRVSLRKMVTAEDIANQVIFLCSP 241 Query: 232 DASLCTG 238 + +G Sbjct: 242 AGASISG 248 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 261 Length adjustment: 24 Effective length of query: 224 Effective length of database: 237 Effective search space: 53088 Effective search space used: 53088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory