Align ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized)
to candidate HSERO_RS05325 HSERO_RS05325 ribose ABC transporter permease
Query= TCDB::Q9WXW7 (317 letters) >FitnessBrowser__HerbieS:HSERO_RS05325 Length = 328 Score = 213 bits (543), Expect = 4e-60 Identities = 110/292 (37%), Positives = 185/292 (63%), Gaps = 3/292 (1%) Query: 15 PLVALVSLAVFTAILNPRFLTAFNLQALGRQIAIFGLLAIGETFVIISGGGAIDLSPGSM 74 PL LV +++ + + F T N + RQ++I G+LA+G +FVI++GG IDLS G+ Sbjct: 32 PLAGLVVVSLLMGLASDNFFTLSNWFNVLRQVSIVGILAVGMSFVILTGG--IDLSVGAA 89 Query: 75 VALTGVMVAWLMTH-GVPVWISVILILLFSIGAGAWHGLFVTKLRVPAFIITLGTLTIAR 133 +AL G + A L+ + G+P ++++ + + G +G V R+PA I+TL T+ +AR Sbjct: 90 MALAGTISAGLIVNSGLPAPLALLCGVGLATCIGLLNGALVAWGRMPAIIVTLATMGVAR 149 Query: 134 GMAAVITKGWPIIGLPSSFLKIGQGEFLKIPIPVWILLAVALVADFFLRKTVYGKHLRAS 193 G+ + + G+PI GLP G G +P+PV ++L V +A L++T +G+H+ A Sbjct: 150 GVGLIYSGGYPISGLPGWISWFGVGRIGMVPVPVILMLIVYALAWLLLQRTAFGRHVYAI 209 Query: 194 GGNEVAARFSGVNVDRVRMIAFMVSGFLAGVVGIIIAARLSQGQPGVGSMYELYAIASTV 253 GGNE+AAR SGV R+++ + +SGF +G+ II+ RL GQP G +EL AIA+ V Sbjct: 210 GGNEMAARLSGVKTTRIKLAVYAISGFTSGLAAIILTGRLMSGQPNAGVGFELDAIAAVV 269 Query: 254 IGGTSLTGGEGSVLGAIVGASIISLLWNALVLLNVSTYWHNVVIGIVIVVAV 305 +GGT++ GG G V+G ++GA ++ +L N L L+ ++ Y +++ G++I++A+ Sbjct: 270 LGGTAIAGGRGLVVGTLIGAVLLGILNNGLNLMGINPYLQDIIRGVIILLAI 321 Lambda K H 0.328 0.143 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 328 Length adjustment: 28 Effective length of query: 289 Effective length of database: 300 Effective search space: 86700 Effective search space used: 86700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory