GapMind for catabolism of small carbon sources

 

Protein 18060 in Escherichia coli BW25113

Annotation: b4032 maltose transporter subunit (NCBI)

Length: 296 amino acids

Source: Keio in FitnessBrowser

Candidate for 27 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-maltose catabolism malG hi ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) (characterized) 100% 100% 582.8 ABC-type maltose transporter (subunit 1/2) (EC 7.5.2.1) 45% 199.9
D-maltose catabolism malG_Aa lo Binding-protein-dependent transport systems inner membrane component (characterized, see rationale) 35% 91% 174.1 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism malG_Bb lo ABC-type Maltose/ Maltodextrin permease (characterized, see rationale) 34% 97% 158.3 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism thuG lo Putative maltose permease, component of MalEFG (K unknown), involved in maltose and maltodextrin uptake (characterized) 32% 92% 146 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism malG_Sm lo MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 95% 139 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
trehalose catabolism malG lo MalG, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 33% 95% 139 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
L-fucose catabolism SM_b21105 lo ABC transporter for L-Fucose, permease component 2 (characterized) 33% 98% 136.3 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
trehalose catabolism thuG lo Trehalose transport system permease protein SugB (characterized) 31% 96% 128.6 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
sucrose catabolism thuG lo ABC transporter for D-Trehalose, permease component 2 (characterized) 31% 96% 123.6 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-sorbitol (glucitol) catabolism mtlG lo ABC transporter for D-Sorbitol, permease component 1 (characterized) 36% 75% 106.7 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 31% 56% 100.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
sucrose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 31% 56% 100.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
trehalose catabolism aglG lo ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized) 31% 56% 100.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-mannitol catabolism mtlG lo MtlG, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 31% 89% 97.8 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-cellobiose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-glucose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
lactose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-mannose catabolism TT_C0326 lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
sucrose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
trehalose catabolism gtsC lo Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized) 30% 97% 95.9 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-cellobiose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-glucose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
lactose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
D-maltose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
sucrose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8
trehalose catabolism aglG' lo Inner membrane ABC transporter permease protein (characterized, see rationale) 33% 54% 94.4 ABC-type maltose transporter (subunit 2/3) (EC 7.5.2.1) 100% 582.8

Sequence Analysis Tools

View 18060 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MAMVQPKSQKARLFITHLLLLLFIAAIMFPLLMVVAISLRQGNFATGSLIPEQISWDHWK
LALGFSVEQADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKAT
LLKGMLIFQMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGY
FETIDSSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDV
NSYTLAVGMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory