Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate 17584 b3523 predicted transporter (NCBI)
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >FitnessBrowser__Keio:17584 Length = 440 Score = 211 bits (538), Expect = 3e-59 Identities = 135/425 (31%), Positives = 216/425 (50%), Gaps = 17/425 (4%) Query: 23 SRIKSIFSGSVGNMVEWYDWYVYA-AFSLYFAKAFFPKGDTTAQLLNTAAIFAVGFLMRP 81 SR K + + +G +E++D+Y+YA A + F FFP+GD TA L + A FA+ F+ RP Sbjct: 19 SRNKVLVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPTAATLQSLATFAIAFVARP 78 Query: 82 IGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQGLS 141 IG + G + DR GRKA L+AS+ M +++I L PGY TIG+ AP+LL AR QGL Sbjct: 79 IGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATIGIFAPLLLALARFGQGLG 138 Query: 142 VGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDWGW 201 +GGE+G +A +E A +R + SF + G A G ++L LT EQ WGW Sbjct: 139 LGGEWGGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGTFLLLSWLLTDEQFMSWGW 198 Query: 202 RIPFAIGALCAIVALYLRRGMEETESFAKKEKSKESA---MRTLL-RHPKELMTVVGLTM 257 R+PF A+ I+ LY+R + E+ F K K+K+ + TLL +H + + + + Sbjct: 199 RVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLGTLLTKHVRVTVLGTFIML 258 Query: 258 GGTLAFYTYTTYMQKYLVNT----VGMSISDSTTISAATLFLFMCLQPIIGGLSDKVGRR 313 FY T Y + +G+ ++ + + F + P+ G L+D GRR Sbjct: 259 ATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIGFGVMVPVAGLLADAFGRR 318 Query: 314 PILIAFGILGTLFTV----PILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAELF 369 ++ L LF + P+L + + I + FL++ ++ + + A++ ELF Sbjct: 319 KSMVIITTLIILFALFAFNPLLGSGNPILVF---AFLLLGLSLMGLTFGPMGALL-PELF 374 Query: 370 PTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVSLLVYVTMKD 429 PTE+R G Y + + A YIA W ++ Y+ A ++L+ + + Sbjct: 375 PTEVRYTGASFSYNVASILGASVAPYIAAWLQTNYGLGAVGLYLAAMAGLTLIALLLTHE 434 Query: 430 TRKHS 434 TR S Sbjct: 435 TRHQS 439 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 597 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 440 Length adjustment: 32 Effective length of query: 407 Effective length of database: 408 Effective search space: 166056 Effective search space used: 166056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory