Align alpha-ketoglutarate permease (MHS family) (characterized)
to candidate 18139 b4111 proline/glycine betaine transporter (NCBI)
Query= reanno::pseudo5_N2C3_1:AO356_17790 (439 letters) >FitnessBrowser__Keio:18139 Length = 500 Score = 228 bits (580), Expect = 4e-64 Identities = 133/425 (31%), Positives = 220/425 (51%), Gaps = 28/425 (6%) Query: 26 KSIFSGSVGNMVEWYDWYVYAAFSLYFAKVFFPKGDTTAQLLNTAAIFAVGFLMRPIGGW 85 K+I + S+GN +EW+D+ VY + KVFFP D + Q++ A F+V FL+RP+GG Sbjct: 25 KAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGADPSVQMVAALATFSVPFLIRPLGGL 84 Query: 86 LMGLYADRAGRKRALMASVYLMCFGSLIIALSPSYETIGVGAPILLVFARLLQGLSVGGE 145 G+ D+ GR++ L ++ +M + I L PSY+TIG+ APILL+ ++ QG SVGGE Sbjct: 85 FFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYDTIGIWAPILLLICKMAQGFSVGGE 144 Query: 146 YGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQFLTTEQLYAWGWRIPF 205 Y ++ +++E + +RGF S+ I+G ++ GV++++ + WGWRIPF Sbjct: 145 YTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTIVGEANFLDWGWRIPF 204 Query: 206 AIGALCAVVALYLRRGMEETESFTK-------------KEKSKESAMRTLLRHPKELMTV 252 I ++ LYLR +EET +F + ++ K S ++ + L+T Sbjct: 205 FIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKYWRSLLTC 264 Query: 253 VGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPVIGGLSDKIGR 312 +GL + + +Y TYM YL + + S I A + + +QPV+G LSD+ GR Sbjct: 265 IGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLIIIAIMIGMLFVQPVMGLLSDRFGR 324 Query: 313 RPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAAL----IIVSGYTSINAVVKAEL 368 RP ++ + + +P +++ LI A L +I++ +T + A + Sbjct: 325 RPFVLLGSVALFVLAIPAFILINS-----NVIGLIFAGLLMLAVILNCFTGVMASTLPAM 379 Query: 369 FPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIG---METGYYWYVTACIAVSLLVYI 425 FPT IR + + ++V + G T +A W M YY V A V L+ + Sbjct: 380 FPTHIRYSALAAAFNISVLVAGLTPT-LAAWLVESSQNLMMPAYYLMVVA--VVGLITGV 436 Query: 426 TMKDT 430 TMK+T Sbjct: 437 TMKET 441 Lambda K H 0.326 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 556 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 500 Length adjustment: 33 Effective length of query: 406 Effective length of database: 467 Effective search space: 189602 Effective search space used: 189602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory