Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate 14935 b0810 glutamine ABC transporter permease protein (NCBI)
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >FitnessBrowser__Keio:14935 Length = 219 Score = 99.0 bits (245), Expect = 1e-25 Identities = 63/203 (31%), Positives = 104/203 (51%), Gaps = 4/203 (1%) Query: 157 GLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSSVM 216 G +TL I+ +G+ G L +G++ R V + FIE RG P++ + Sbjct: 18 GAKMTLWISVLGLAGGLVIGLLAGFARTFGGWIANHVALVFIEVIRGTPIVVQVMFIYFA 77 Query: 217 LPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSMG 276 LP+ + + D A++ +++ AYIAE+ RG + +I KG EA A+GL W ++ Sbjct: 78 LPMAFND-LRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGFREAGLALGLSRWETIR 136 Query: 277 LVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMATEGYVF 336 VILP AL+ ++P + N +I KDTSL I+IG+ +L ++ A A E + Sbjct: 137 YVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEIIAGN---FRALEIWSA 193 Query: 337 AALVFWIFCFGMSRYSMHLERKL 359 A+ + I +S LER++ Sbjct: 194 VAVFYLIITLVLSFILRRLERRM 216 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 219 Length adjustment: 26 Effective length of query: 339 Effective length of database: 193 Effective search space: 65427 Effective search space used: 65427 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory