Align Uncharacterized protein (characterized, see rationale)
to candidate 14444 b0306 predicted oxidoreductase (NCBI)
Query= uniprot:B2TBW0 (256 letters) >FitnessBrowser__Keio:14444 Length = 239 Score = 132 bits (331), Expect = 8e-36 Identities = 84/247 (34%), Positives = 124/247 (50%), Gaps = 16/247 (6%) Query: 10 MKVALFIPCFIDAFYPEVGIATLELLERFGIQVDYPQEQTCCGQPMANSGAHAEAA-GTE 68 M V F+ C DA + ++ LLE+ G +V++P++Q CCGQP NSG EA G + Sbjct: 1 MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQPAINSGYIKEAIPGMK 60 Query: 69 RVFARNFAGYDYIVGPSASCIHHVREHLTAL----EQTDEVKKVRANAYELVEFLHDVVG 124 + A D I+ P+ SC + V+ + T L E KV A +L F+ + +G Sbjct: 61 NLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAAKVAARMQDLTSFIVNKLG 120 Query: 125 AREFPWAEFPHRVGLHNSCSALRHLKEASISEVAGAPFSKPRTLLEGVKGIEFVKPARPD 184 + A R H SCS R L +P TLL+ V+G+E + A D Sbjct: 121 VVDVG-ASLQGRAVYHPSCSLARKLGVKD----------EPLTLLKNVRGLELLTFAEQD 169 Query: 185 ECCGFGGTFSVTEEPVSVRMGQDKVRDHLNAGAEYIVSGDMSCLMHQQGCAERMKADARF 244 CCGFGGTFSV +S M ++KV + EY++ D+SCL++ G +R + Sbjct: 170 TCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQREGQKVKV 229 Query: 245 IHIAQVL 251 +HIA+VL Sbjct: 230 MHIAEVL 236 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 239 Length adjustment: 24 Effective length of query: 232 Effective length of database: 215 Effective search space: 49880 Effective search space used: 49880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory