GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagEcb in Escherichia coli BW25113

Align N-acetylglucosamine-specific PTS system, IIBC components (nagE) (characterized)
to candidate 15742 b1621 fused maltose and glucose-specific PTS enzymes: IIB component -! IIC component (NCBI)

Query= reanno::BFirm:BPHYT_RS02745
         (591 letters)



>lcl|FitnessBrowser__Keio:15742 b1621 fused maltose and
           glucose-specific PTS enzymes: IIB component -! IIC
           component (NCBI)
          Length = 530

 Score =  291 bits (745), Expect = 5e-83
 Identities = 190/514 (36%), Positives = 271/514 (52%), Gaps = 65/514 (12%)

Query: 10  QRLGRALMLPIAVLPVAGLLLRLGQP----DVFNI-------------KMIADAGGAIFD 52
           Q+LG+  MLP+A+L   G++L +G      DV  +               ++  G   F 
Sbjct: 16  QQLGKTFMLPVALLSFCGIMLGIGSSLSSHDVITLIPVLGNPVLQAIFTWMSKIGSFAFS 75

Query: 53  NLPLLFAIGVAVGFAKDNNGVAGLAGAIGYLI------------------EVAVMKDIN- 93
            LP++F I + +G A++N GVA  AG IGY +                  + AV+K  N 
Sbjct: 76  FLPVMFCIAIPLGLARENKGVAAFAGFIGYAVMNLAVNFWLTNKGILPTTDAAVLKANNI 135

Query: 94  ------DKLNMGVLSGIVAGIVAGLLYNRYKDIKLPDYLAFFGGKRFVPIVTGVVCLVLG 147
                   ++ G+L  ++AGI+  +L+ R+ +I+LPD LAFFGG RFVPI++ +V  ++G
Sbjct: 136 QSILGIQSIDTGILGAVIAGIIVWMLHERFHNIRLPDALAFFGGTRFVPIISSLVMGLVG 195

Query: 148 IAFGYVWQPVQAVIDTAGHWLTTAGALGAFVFGVLNRLLLVTGLHHILNSLTWFV-FGTF 206
           +    VW      I   GH + +AG  G  +FG   RLLL  GLHHIL +L  F   G  
Sbjct: 196 LVIPLVWPIFAMGISGLGHMINSAGDFGPMLFGTGERLLLPFGLHHILVALIRFTDAGGT 255

Query: 207 TPPGGAAVTGDLHRFFA--GDPTAGTF--------MTGFFPVMMFGLPAACLAMFHEAPK 256
               G  V+G L  F A    PT   F          G  P  + GLP A LAM+H A  
Sbjct: 256 QEVCGQTVSGALTIFQAQLSCPTTHGFSESATRFLSQGKMPAFLGGLPGAALAMYHCARP 315

Query: 257 ERRAVVGGLLFSMALTSFLTGVTEPIEFSFMFLAPVLYVIHALLTGISLAICSALGIHLG 316
           E R  + GLL S  +   + G TEP+EF F+F+APVLYVIHALLTG+   + S LG+ +G
Sbjct: 316 ENRHKIKGLLISGLIACVVGGTTEPLEFLFLFVAPVLYVIHALLTGLGFTVMSVLGVTIG 375

Query: 317 FTFSAGAIDYV---LNYGLSTRGWWAIP-IGLVYMVVYYGLFRFFIRKFNMATPGREPAA 372
            T     ID+V   + +GLST+ W+ +P +  ++ VVYY +FRF I +FN+ TPGR+   
Sbjct: 376 NT-DGNIIDFVVFGILHGLSTK-WYMVPVVAAIWFVVYYVIFRFAITRFNLKTPGRDSEV 433

Query: 373 ADEQVDSFAAGGFVSPVAGTAVPRAQRYIAALGGASNLSVVDACTTRLRLSVVDSNKVSE 432
           A   ++   AG       G +       + ALGGA N+  +D C TRLRLSV D + V+ 
Sbjct: 434 A-SSIEKAVAG-----APGKSGYNVPAILEALGGADNIVSLDNCITRLRLSVKDMSLVNV 487

Query: 433 NELKTIGARGVLKRGSTNVQVIIGPEADIIADEI 466
             LK   A GV++    N+QV+IGP+   + DE+
Sbjct: 488 QALKDNRAIGVVQLNQHNLQVVIGPQVQSVKDEM 521



 Score = 35.8 bits (81), Expect = 5e-06
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 4/90 (4%)

Query: 491 AAPVAASVAQGSGPLDPDPLRWLAVFGGAGNVLSLDAIAATRLRIVVRDPSAVDRQRL-- 548
           A+ +  +VA   G    +    L   GGA N++SLD    TRLR+ V+D S V+ Q L  
Sbjct: 434 ASSIEKAVAGAPGKSGYNVPAILEALGGADNIVSLDN-CITRLRLSVKDMSLVNVQALKD 492

Query: 549 -ATLDTAWISADTFHIVVGDAAQRYAEKLA 577
              +    ++     +V+G   Q   +++A
Sbjct: 493 NRAIGVVQLNQHNLQVVIGPQVQSVKDEMA 522


Lambda     K      H
   0.325    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 986
Number of extensions: 52
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 591
Length of database: 530
Length adjustment: 36
Effective length of query: 555
Effective length of database: 494
Effective search space:   274170
Effective search space used:   274170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory