GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Escherichia coli BW25113

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate 16515 b2416 PEP-protein phosphotransferase of PTS system (enzyme I) (NCBI)

Query= reanno::BFirm:BPHYT_RS02740
         (854 letters)



>lcl|FitnessBrowser__Keio:16515 b2416 PEP-protein phosphotransferase
           of PTS system (enzyme I) (NCBI)
          Length = 575

 Score =  355 bits (912), Expect = e-102
 Identities = 207/556 (37%), Positives = 314/556 (56%), Gaps = 15/556 (2%)

Query: 293 LAGVCAAPGVAVGK--LVRWDDADIDPPEKANGTSAAESRLLDKAIATVDADLDTTVRDA 350
           ++G+ A+PG+A GK  L++ D+  ID  + +      E        A   A L+T    A
Sbjct: 2   ISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTKA 61

Query: 351 SQRGAVGEAGIFSVHRVLLEDPTLLDAARDLISLGK----SAGFAWREAIRAQIAILTNI 406
            +     +  IF  H +LLED  L    +++I+L K    +A  A  E I  Q + L  +
Sbjct: 62  GETFGEEKEAIFEGHIMLLEDEEL---EQEIIALIKDKHMTADAAAHEVIEGQASALEEL 118

Query: 407 EDALLAERAADLRDIEKRVLR-ALGYTSATARTLPEEAVLAAEEFTPSDLSTLDRSRVTA 465
           +D  L ERAAD+RDI KR+LR  LG        + +E +L A + TPS+ + L+  +V  
Sbjct: 119 DDEYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLG 178

Query: 466 LVMARGGATSHAAILARQAGIPALVAVGDALHAIPEGTQVVVNATTGRLEFAPTELDVER 525
            +   GG TSH +I+AR   +PA+V  G     +     ++++A   ++   PT   +++
Sbjct: 179 FITDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDK 238

Query: 526 ARLERTRLADVREANRRTSQQAAVTSDGRAIEVAANIATLDDAKTAVENGADSVGLLRTE 585
            R  + ++A  +    +     A+T DG  +EV ANI T+ D + A  NGA+ VGL RTE
Sbjct: 239 MRAVQEQVASEKAELAKLKDLPAITLDGHQVEVCANIGTVRDVEGAERNGAEGVGLYRTE 298

Query: 586 LLFIHRAAAPTTDEHRQSYQAIVDALSGRTAIIRTLDVGADKEVDYLTLPPEPNPALGLR 645
            LF+ R A PT +E   +Y+A+ +A   +  I+RT+D+G DKE+ Y+  P E NP LG R
Sbjct: 299 FLFMDRDALPTEEEQFAAYKAVAEACGSQAVIVRTMDIGGDKELPYMNFPKEENPFLGWR 358

Query: 646 GIRLAQVRPDLLDDQLRGLLAVQPLGAVRILLPMVTDVGELIRIRKRIDEFAREL---GR 702
            IR+A  R ++L DQLR +L     G +RI+ PM+  V E+  +RK I+ + +EL   G+
Sbjct: 359 AIRIAMDRREILRDQLRAILRASAFGKLRIMFPMIISVEEVRALRKEIEIYKQELRDEGK 418

Query: 703 T--EPIEVGVMIEVPSAALLADQLAQHADFLSIGTNDLTQYTLAMDRCQADLAAQADGLH 760
              E IE+GVM+E P+AA +A  LA+  DF SIGTNDLTQYTLA+DR    ++     + 
Sbjct: 419 AFDESIEIGVMVETPAAATIARHLAKEVDFFSIGTNDLTQYTLAVDRGNDMISHLYQPMS 478

Query: 761 PAVLRLIAATVQGADKHGKWVGVCGALAGDPLAMPLLVGLGVTELSVDPVSVPGIKARVR 820
           P+VL LI   +  +   GKW G+CG LAGD  A  LL+G+G+ E S+  +S+P IK  +R
Sbjct: 479 PSVLNLIKQVIDASHAEGKWTGMCGELAGDERATLLLLGMGLDEFSMSAISIPRIKKIIR 538

Query: 821 NLDYQLCRQRAQDALA 836
           N +++  +  A+ ALA
Sbjct: 539 NTNFEDAKVLAEQALA 554


Lambda     K      H
   0.317    0.133    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 891
Number of extensions: 44
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 854
Length of database: 575
Length adjustment: 39
Effective length of query: 815
Effective length of database: 536
Effective search space:   436840
Effective search space used:   436840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory