GapMind for catabolism of small carbon sources

 

Aligments for a candidate for cycA in Escherichia coli BW25113

Align L-alanine and D-alanine permease (characterized)
to candidate 14540 b0402 predicted cryptic proline transporter (NCBI)

Query= reanno::WCS417:GFF1065
         (472 letters)



>lcl|FitnessBrowser__Keio:14540 b0402 predicted cryptic proline
           transporter (NCBI)
          Length = 457

 Score =  526 bits (1354), Expect = e-154
 Identities = 248/451 (54%), Positives = 335/451 (74%)

Query: 18  LKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALGEMA 77
           LKR L  RHIR MALG+ IG GLF GSA AI+MAGP+++L+YIIGG+A  +IMRALGEM+
Sbjct: 7   LKRGLSTRHIRFMALGSAIGTGLFYGSADAIKMAGPSVLLAYIIGGIAAYIIMRALGEMS 66

Query: 78  VHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGVWFPDTPRWIW 137
           VHNP A SFSRYAQ+ LGPLAG++TGW Y F  L+  +A++TA  +YMGVWFP  P WIW
Sbjct: 67  VHNPAASSFSRYAQENLGPLAGYITGWTYCFEILIVAIADVTAFGIYMGVWFPTVPHWIW 126

Query: 138 ALAALISMGSINLIAVKAFGEFEFWFALIKIVTIIAMVIGGVGIIAFGFGNDGVALGISN 197
            L+ ++ + ++NL++VK FGE EFWF+  K+ TII M++ G GII +G GN G   GI N
Sbjct: 127 VLSVVLIICAVNLMSVKVFGELEFWFSFFKVATIIIMIVAGFGIIIWGIGNGGQPTGIHN 186

Query: 198 LWAHGGFMPNGVQGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPSAIGSVFWRILLF 257
           LW++GGF  NG  G++MSLQMVMFAY G+E+IG+TAGEAK+P+K+IP AI SV  RIL+F
Sbjct: 187 LWSNGGFFSNGWLGMVMSLQMVMFAYGGIEIIGITAGEAKDPEKSIPRAINSVPMRILVF 246

Query: 258 YVGALFVILSIYPWNEIGTQGSPFVMTFERLGIKTAAGIINFVVITAALSSCNGGIFSTG 317
           YVG LFVI+SIYPWN++GT GSPFV+TF+ +GI  AA I+NFVV+TA+LS+ N  +F  G
Sbjct: 247 YVGTLFVIMSIYPWNQVGTAGSPFVLTFQHMGITFAASILNFVVLTASLSAINSDVFGVG 306

Query: 318 RMLYSLAQNGQAPATFAKTSSNGVPRKALLLSIFALLLGVLLNYLVPEKVFVWVTSIATF 377
           RML+ +A+ G AP  F+KTS  G+P   +L+   ALL  V LNY++PE VF+ + S+ATF
Sbjct: 307 RMLHGMAEQGSAPKIFSKTSRRGIPWVTVLVMTTALLFAVYLNYIMPENVFLVIASLATF 366

Query: 378 GAIWTWLMILLAQLKFRKSLSPAEQAGLKYRMWLYPVSSYLALAFLLLVVGLMAYFPDTR 437
             +W W+MILL+Q+ FR+ L P E   LK+++     ++   L FLL ++GL+ Y PDTR
Sbjct: 367 ATVWVWIMILLSQIAFRRRLPPEEVKALKFKVPGGVATTIGGLIFLLFIIGLIGYHPDTR 426

Query: 438 IALYVGPVFLVLLTVLFYVFKLQPTQVAQGE 468
           I+LYVG  ++V+L + +   +    Q+A+ +
Sbjct: 427 ISLYVGFAWIVVLLIGWMFKRRHDRQLAENQ 457


Lambda     K      H
   0.328    0.142    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 715
Number of extensions: 36
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 472
Length of database: 457
Length adjustment: 33
Effective length of query: 439
Effective length of database: 424
Effective search space:   186136
Effective search space used:   186136
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory