Align Inner-membrane translocator (characterized, see rationale)
to candidate 15635 b1514 AI2 transporter (NCBI)
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Keio:15635 Length = 342 Score = 146 bits (368), Expect = 1e-39 Identities = 108/345 (31%), Positives = 176/345 (51%), Gaps = 18/345 (5%) Query: 61 RYLWPLLALSILLLANLFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIAT 120 R + LLA+ +L + F+D + ++ +L + + + + LL++G +LV+ T Sbjct: 9 REITALLAVVLLFVLPGFLDRQYLSVQ--------TLTMVYSSAQILILLAMGATLVMLT 60 Query: 121 GGIDLSVGAVMAIAGAVCANLLLVPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIV 180 ID+SVG++ + AV +LL SL A L++GLLAG NG LV++L I IV Sbjct: 61 RNIDVSVGSITGMC-AVLLGMLLNAGYSLPVACVATLLLGLLAGFFNGVLVAWLKIPAIV 119 Query: 181 ATLLLMVAGRGVAQLINQGQIITFQHPGFAAIGVGQFLGLPMPVWIVIGMLTFSQLLLRK 240 ATL + RG+ L G+ I + LG+ W+ I ++ F LL K Sbjct: 120 ATLGTLGLYRGIMLLWTGGKWIEGLPAELKQLSAPLLLGVSAIGWLTIILVAFMAWLLAK 179 Query: 241 TALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDANNAGL 300 TA G A G N + +R LG+ ++I++ A+ + G AALAG++ + I G N G Sbjct: 180 TAFGRSFYATGDNLQGARQLGVRTEAIRIVAFSLNGCMAALAGIVFASQI-GFIPNQTGT 238 Query: 301 WLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIKAIVIL 360 LE+ A+ A V+GG +L GG ++I +V+GA + + + +++ +PA +N I +V+L Sbjct: 239 GLEMKAIAACVLGGISLLGGSGAIIGAVLGAWFLTQIDSVLVLLRIPAWWNDFIAGLVLL 298 Query: 361 TVLLLQ-------SAKFRRQLSALFKSKRHADAKPAEKATSAKAS 398 VL+ RRQ A F + KPA +A+ Sbjct: 299 AVLVFDGRLRCALERNLRRQKYARFMTP-PPSVKPASSGKKREAA 342 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 302 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 342 Length adjustment: 30 Effective length of query: 375 Effective length of database: 312 Effective search space: 117000 Effective search space used: 117000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory