GapMind for catabolism of small carbon sources


Alignments for a candidate for glcB in Escherichia coli BW25113

Align Malate synthase G; MSG; EC (characterized)
to candidate 17054 b2976 malate synthase (NCBI)

Query= SwissProt::P37330
         (723 letters)

          Length = 723

 Score = 1449 bits (3750), Expect = 0.0
 Identities = 723/723 (100%), Positives = 723/723 (100%)













Query: 721 ESH 723
Sbjct: 721 ESH 723

Lambda     K      H
   0.318    0.134    0.394 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1808
Number of extensions: 61
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 723
Length of database: 723
Length adjustment: 40
Effective length of query: 683
Effective length of database: 683
Effective search space:   466489
Effective search space used:   466489
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

Align candidate 17054 b2976 (malate synthase (NCBI))
to HMM TIGR01345 (glcB: malate synthase G (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01345.hmm
# target sequence database:        /tmp/gapView.26485.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01345  [M=721]
Accession:   TIGR01345
Description: malate_syn_G: malate synthase G
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
          0 1434.0   0.2          0 1433.8   0.2    1.0  1  lcl|FitnessBrowser__Keio:17054  b2976 malate synthase (NCBI)

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Keio:17054  b2976 malate synthase (NCBI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1433.8   0.2         0         0       1     721 []       3     723 .]       3     723 .] 0.99

  Alignments for each domain:
  == domain 1  score: 1433.8 bits;  conditional E-value: 0
                       TIGR01345   1 ervdagrlqvakklkdfveeevlpgtgvdaekfwsgfdeivrdlapenrellakrdeiqaaideyhrknk.gvidkeay 78 
                                     ++++++rl++++++k+fv+eevlpgtg+da++fw++fdeiv+dlapenr+lla+rd+iqaa+de+hr+n+ +v+dk+ay
                                     5899******************************************************************7899***** PP

                       TIGR01345  79 ksflkeigylveepervtietenvdseiasqagpqlvvpvlnaryalnaanarwgslydalygsnvipeedgaekgkey 157
                                     ksfl+e+gylv++pervt+et+++dsei+sqagpqlvvp++naryalnaanarwgslydalygs++ip+e+++++g  y
                                     ****************************************************************************..* PP

                       TIGR01345 158 npkrgekviefarefldeslplesgsyadvvkykivdkklavqlesgkvtrlkdeeqfvgyrgdaadpevillktnglh 236
                                     ******************************************************************************* PP

                       TIGR01345 237 ielqidarhpigkadkakvkdivlesaittildcedsvaavdaedkvlvyrnllglmkgtlkeklekngriikrklned 315
                                     ******************************************************************************* PP

                       TIGR01345 316 rsytaangeelslhgrsllfvrnvghlmtipviltdegeeipegildgvltsvialydlkvqnklrnsrkgsvyivkpk 394
                                     r+ytaa+g+e+slhgrsllf+rnvghlmtipvi+++eg+eipegildgv+t++ialydlkvq   +nsr+gsvyivkpk
                                     *************************************************************5...6************* PP

                       TIGR01345 395 mhgpeevafanklftriedllglerhtlkvgvmdeerrtslnlkaciakvkervafintgfldrtgdeihtsmeagamv 473
                                     ******************************************************************************* PP

                       TIGR01345 474 rkadmksapwlkayernnvaagltcglrgkaqigkgmwampdlmaemlekkgdqlragantawvpsptaatlhalhyhr 552
                                     ******************************************************************************* PP

                       TIGR01345 553 vdvqkvqkeladaerrae....lkeiltipvaentnwseeeikeeldnnvqgilgyvvrwveqgigcskvpdihnvalm 627
                                     ++vq+vq+++a++e++ae    l+++ltipvaen+nws++ei++eldnnvqgilgyvvrwveqgigcskvpdihnvalm
                                     *****************999999******************************************************** PP

                       TIGR01345 628 edratlrissqhlanwlrhgivskeqvleslermakvvdkqnagdeayrpmadnleasvafkaakdlilkgtkqpsgyt 706
                                     edratlrissqh+anwlrhgi++keqv++sle+makvvd+qnagd+ayrpma+n+++s+afkaa+dli+ g+kqp+gyt
                                     ******************************************************************************* PP

                       TIGR01345 707 epilharrlefkekn 721
  lcl|FitnessBrowser__Keio:17054 709 EPLLHAWRLREKESH 723
                                     ************986 PP

Internal pipeline statistics summary:
Query model(s):                            1  (721 nodes)
Target sequences:                          1  (723 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.05u 0.01s 00:00:00.06 Elapsed: 00:00:00.06
# Mc/sec: 8.24

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory