Align Xylose/arabinose import permease protein XacH (characterized, see rationale)
to candidate 17513 b3452 glycerol-3-phosphate transporter subunit (NCBI)
Query= uniprot:D4GP36 (317 letters) >FitnessBrowser__Keio:17513 Length = 295 Score = 90.1 bits (222), Expect = 6e-23 Identities = 65/207 (31%), Positives = 104/207 (50%), Gaps = 10/207 (4%) Query: 104 FTTIC-LVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILNLV 162 F T+ L++ LF A L+++ +R S +QT+ LLP +++ V A LW+++FN G++ Sbjct: 81 FVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHF 140 Query: 163 VTTLGFNPVDW--LGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAARVDGA 220 + G+ DW N A+ V+ A +W+ Y + + A LQSIP EAA +DGA Sbjct: 141 LAEFGY---DWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGA 197 Query: 221 SITRTYLRIIVPQLKEASVSAAVVLMVFA-LKAFTFLYALVGRYRPPNGTDILATLMVRR 279 R + +I +P + S VV +V+A F + A P T L + R Sbjct: 198 GPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG-GPVQATTTLIYKIYRE 256 Query: 280 AFKFGEWAYSAA--IATMLLIMALGVI 304 F + A SAA + M L++ L V+ Sbjct: 257 GFTGLDLASSAAQSVVLMFLVIVLTVV 283 Lambda K H 0.326 0.140 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 295 Length adjustment: 27 Effective length of query: 290 Effective length of database: 268 Effective search space: 77720 Effective search space used: 77720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory