Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate 14400 b0262 putative ATP-binding component of a transport system (VIMSS)
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__Keio:14400 Length = 348 Score = 224 bits (571), Expect = 3e-63 Identities = 128/308 (41%), Positives = 187/308 (60%), Gaps = 15/308 (4%) Query: 6 LDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETVTEGEL 65 L +VTK + G ++ I+L I G+ + L+GPSGCGK+T LR++AGLE +EG++ Sbjct: 9 LRNVTKRF-----GSNTVIDNINLTIPQGQMVTLLGPSGCGKTTILRLVAGLEKPSEGQI 63 Query: 66 RLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRVEETTD 125 ++ + S Q RDI MVFQSYAL+PH S+ N+ +GL+ G+P E++ RV+E Sbjct: 64 FIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK-MLGVPRAELKARVKEALA 122 Query: 126 MLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQRL 185 M+ + DR Q+SGGQQQRVAL RA++ P+V L DEPLSNLDA LR MR +++ L Sbjct: 123 MVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMRDKIREL 182 Query: 186 QGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFIGEPSM 245 Q + +T++YVTHDQ+EA + D V V++ G + Q+G+P D Y +P + F+A F+G+ Sbjct: 183 QKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQDLYRQPASRFMASFMGD--A 240 Query: 246 NLFDGSLSGDTFRGDGFDYPLSGATRDQLGGASGL-TLGIRPEDVTVGER-RSGQRTFDA 303 NLF + S G+ P R G G +G+RPE +T+ +R QR Sbjct: 241 NLFPATFSDGYVDIYGYHLP-----RPLHFGTQGEGMVGVRPEAITLSDRGEESQRCVIR 295 Query: 304 EVVVVEPQ 311 V + PQ Sbjct: 296 HVAYMGPQ 303 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 348 Length adjustment: 30 Effective length of query: 353 Effective length of database: 318 Effective search space: 112254 Effective search space used: 112254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory