Align succinyl-CoA-glutarate CoA-transferase (EC 2.8.3.13) (characterized)
to candidate 16479 b2374 formyl-coenzyme A transferase (NCBI)
Query= reanno::pseudo5_N2C3_1:AO356_10845 (406 letters) >FitnessBrowser__Keio:16479 Length = 416 Score = 191 bits (486), Expect = 3e-53 Identities = 132/421 (31%), Positives = 205/421 (48%), Gaps = 35/421 (8%) Query: 4 LSHLRVLDLSRVLAGPWAGQILADLGADVIKVERPGNGDDTRAWGPPFLKDARGENTTEA 63 L ++VLD + V +GP Q+LA GADVIK+ERPG GD TR R +A Sbjct: 5 LQGIKVLDFTGVQSGPSCTQMLAWFGADVIKIERPGVGDVTR-------HQLRDIPDIDA 57 Query: 64 AYYLSANRNKQSVTIDFTRPEGQRLVRELAAKSDILIENFKVGGLAAYGLDYDSLKAINP 123 Y+ N NK+S+ ++ EG+ ++ +L ++DIL+ENF G + G ++ ++ INP Sbjct: 58 LYFTMLNSNKRSIELNTKTAEGKEVMEKLIREADILVENFHPGAIDHMGFTWEHIQEINP 117 Query: 124 QLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPEGDEGAGPVKVGVALTDILTG 183 +LI+ SI GF + PY Y+ + Q GG S TG +G P+ AL D TG Sbjct: 118 RLIFGSIKGFDECSPYVNVKAYENVAQAAGGAASTTGFWDGP----PLVSAAALGDSNTG 173 Query: 184 LYSTAAILAALAHRDHVGGGQHIDMALLDV-----QVACLANQAMNYL------------ 226 ++ +LAAL HR+ G GQ + M++ D +V Q ++ L Sbjct: 174 MHLLIGLLAALLHREKTGRGQRVTMSMQDAVLNLCRVKLRDQQRLDKLGYLEEYPQYPNG 233 Query: 227 TTGNAPKRLGNAHPN-----IVPYQDFPTADGDFILTVGNDGQFRKFAEVAGQPQWADDP 281 T G+A R GNA I+ + + T +I + + + G+P+W DP Sbjct: 234 TFGDAVPRGGNAGGGGQPGWILKCKGWETDPNAYIYFTIQEQNWENTCKAIGKPEWITDP 293 Query: 282 RFATNKVRVANRAVLIPLIRQATVFKTTAEWVTQLEQAGVPCGPINDLAQVFADPQVQAR 341 ++T R + + I + TV E V L Q +PC P+ + ++ DP ++ Sbjct: 294 AYSTAHARQPHIFDIFAEIEKYTVTIDKHEAVAYLTQFDIPCAPVLSMKEISLDPSLRQS 353 Query: 342 GLAMELPHLLAGKVPQVASPIRLSETPVEYRNAPPLLGEHTLEVLQRVLGLDEAAVMAFR 401 G +E+ L GK V P++ S + + A PLLGEHT VLQ LG + + A + Sbjct: 354 GSVVEVEQPLRGKYLTVGCPMKFSAFTPDIK-AAPLLGEHTAAVLQE-LGYSDDEIAAMK 411 Query: 402 E 402 + Sbjct: 412 Q 412 Lambda K H 0.319 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 416 Length adjustment: 31 Effective length of query: 375 Effective length of database: 385 Effective search space: 144375 Effective search space used: 144375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory