Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate 17422 b3359 bifunctional acetylornithine aminotransferase/ succinyldiaminopimelate aminotransferase (NCBI)
Query= BRENDA::P42588 (459 letters) >FitnessBrowser__Keio:17422 Length = 406 Score = 194 bits (494), Expect = 3e-54 Identities = 121/329 (36%), Positives = 181/329 (55%), Gaps = 19/329 (5%) Query: 71 GSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELL--DPLRAM 128 G + + D QG+E++D GG + +GH +P +V+A++ Q + H + +P + Sbjct: 31 GQGSRIWDQQGKEYVDFAGGIAVTALGHCHPALVNALKTQ-GETLWHISNVFTNEPALRL 89 Query: 129 LAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAYQSPRG---KFTFIATSGAFHGKSL 185 K + A ++ F NSGTE+ E A KLA+ Y R K IA AFHG+SL Sbjct: 90 GRKLIEATFAERV---VFMNSGTEANETAFKLARHYACVRHSPFKTKIIAFHNAFHGRSL 146 Query: 186 GALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGG 245 +S + + F P HVPF ++ A++ ++ D AV++EPIQGEGG Sbjct: 147 FTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVKAVMD------DHTCAVVVEPIQGEGG 200 Query: 246 VILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGG 305 V P +L +R+LCD+ AL++ DEVQ GMGRTG +FA H V PDIL AKALGGG Sbjct: 201 VTAATPEFLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHYGVTPDILTSAKALGGG 260 Query: 306 VMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDM 365 PI A + T E+ S +P H +T+GGNPLACA A A +++ + + K Sbjct: 261 -FPISAMLTTAEIASAF--HPGSHGSTYGGNPLACAVAGAAFDIINTPEVLEGIQAKRQR 317 Query: 366 LLDGFRQLAREYPDLVQEARGKGMLMAIE 394 +D +++ ++Y D+ + RG G+L+ E Sbjct: 318 FVDHLQKIDQQY-DVFSDIRGMGLLIGAE 345 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 406 Length adjustment: 32 Effective length of query: 427 Effective length of database: 374 Effective search space: 159698 Effective search space used: 159698 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory