Align Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11) (characterized)
to candidate 17910 b3870 glutamine synthetase (NCBI)
Query= reanno::BFirm:BPHYT_RS23160 (444 letters) >FitnessBrowser__Keio:17910 Length = 469 Score = 134 bits (337), Expect = 6e-36 Identities = 123/398 (30%), Positives = 175/398 (43%), Gaps = 38/398 (9%) Query: 62 GTLTGVTDPDMVCVPDASTIRMIPWAVDPTAQVIHDCVHFDGTPVAIS--PRRVLRRVLE 119 G G+ + DMV +PDAST + P+ D T + D + GT PR + +R + Sbjct: 56 GGWKGINESDMVLMPDASTAVIDPFFADSTLIIRCDILE-PGTLQGYDRDPRSIAKRAED 114 Query: 120 LYKAKGWKPVI--APELEFYLVD-----------------MNKDPDLPLQPPIGRTG-RP 159 ++ G + PE EF+L D + + Q G G RP Sbjct: 115 YLRSTGIADTVLFGPEPEFFLFDDIRFGSSISGSHVAIDDIEGAWNSSTQYEGGNKGHRP 174 Query: 160 ETGRQAYSIEAVNEFDPLFEDIYEYCEVQELEVDTLIHEVGAA-QMEINFMHGDPLKLAD 218 + + V+ + ++ E L V+ HEV A Q E+ K AD Sbjct: 175 AVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKAD 234 Query: 219 SVFLFKRTVREAALRHKMYATFMAKPMEGEPGSAMHMHQSLVDEETGHNLFTGPDGKPTS 278 + ++K V A R ATFM KPM G+ GS MH H SL + G NLF G S Sbjct: 235 EIQIYKYVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSL--SKNGVNLFAGDKYAGLS 292 Query: 279 -LFTSYIAGLQKYTPALMPIFAPYINSYRRLSRFMAAPINVAWGYDNRTVGFRIP-HSGP 336 YI G+ K+ A+ + P NSY+RL AP+ +A+ NR+ RIP S P Sbjct: 293 EQALYYIGGVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVSSP 352 Query: 337 AARRIENRIPGVDCNPYLAIAATLAAGYLGMTQKLEATEPLLSDGYELP-------YQLP 389 ARRIE R P NPYL AA L AG G+ K+ E + + Y+LP Q+ Sbjct: 353 KARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVA 412 Query: 390 RNLEEGLTLMGACEPIAE---VLGEKFVKAYLALKETE 424 +LEE L + + V ++ + AY+AL+ E Sbjct: 413 GSLEEALNELDLDREFLKAGGVFTDEAIDAYIALRREE 450 Lambda K H 0.321 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 480 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 469 Length adjustment: 33 Effective length of query: 411 Effective length of database: 436 Effective search space: 179196 Effective search space used: 179196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory