Align Amino-acid permease GAP1 (characterized)
to candidate 14712 b0576 phenylalanine transporter (NCBI)
Query= SwissProt::Q5AG77 (582 letters) >FitnessBrowser__Keio:14712 Length = 458 Score = 260 bits (664), Expect = 1e-73 Identities = 149/410 (36%), Positives = 233/410 (56%), Gaps = 13/410 (3%) Query: 71 LQRKLKTRHLQMIAIGSSIGTGLFVGTGGALSTGGPAAIVLAWAISAISVFMTMQGLGEL 130 L R L RH+Q+IA+G +IGTGLF+G G A+ GPA ++L + ++ I F+ M+ LGE+ Sbjct: 19 LHRGLHNRHIQLIALGGAIGTGLFLGIGPAIQMAGPA-VLLGYGVAGIIAFLIMRQLGEM 77 Query: 131 AVAFPVSGGFNLYASKFLEPGIGFAVGWNYFLQFFVLLPLELVAGAITIKYWNASINSDV 190 V PVSG F +A K+ P GF GWNY++ F ++ EL A I ++YW + + + Sbjct: 78 VVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTAAGIYMQYWFPDVPTWI 137 Query: 191 FVIIFWFVVLVITMLGVRWYGEAELVFCTIKVIAVIGFIILGIVLICGGGPNHEFIGGKY 250 + F+ ++ + ++ VR YGE E F IKV+A+IG I G+ L+ G + Sbjct: 138 WAAAFFIIINAVNLVNVRLYGETEFWFALIKVLAIIGMIGFGLWLLFSGHGGEKASIDNL 197 Query: 251 WREPGPFANSFKGFASSLITAAFSFGGTEMIALTASESSNVRHALPKAIKQVFWRIVIFY 310 WR G FA + G SL FSFGG E+I +TA+E+ + ++PKA+ QV +RI++FY Sbjct: 198 WRYGGFFATGWNGLILSLAVIMFSFGGLELIGITAAEARDPEKSIPKAVNQVVYRILLFY 257 Query: 311 LGSIIMIATLVPYNDKRLLGSSSVDVTASPFTIAIVNGGIKGLPSVINAVILISVLSVGN 370 +GS++++ L P+ + V +SPF + N + S +N VIL++ LSV N Sbjct: 258 IGSLVVLLALYPWVE--------VKSNSSPFVMIFHNLDSNVVASALNFVILVASLSVYN 309 Query: 371 ASVYATSRTLNSLAEQGMAPKWTGYIDRAGRPLFAILITNVFGLFALIAADNEKQVVAFN 430 + VY+ SR L L+ QG APK+ + R G P+ +++++ ++ Q AF Sbjct: 310 SGVYSNSRMLFGLSVQGNAPKFLTRVSRRGVPINSLMLSGAITSLVVLINYLLPQ-KAFG 368 Query: 431 WLLALSGLSSIFTWMSINLSHIRFRRAMKVQNRSLTELPFVAQSGVWGSY 480 L+AL + + W+ I L+H+RFR AM+ Q R E F A +G+Y Sbjct: 369 LLMALVVATLLLNWIMICLAHLRFRAAMRRQGR---ETQFKALLYPFGNY 415 Lambda K H 0.325 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 721 Number of extensions: 44 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 582 Length of database: 458 Length adjustment: 35 Effective length of query: 547 Effective length of database: 423 Effective search space: 231381 Effective search space used: 231381 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory