Align PP1070, component of Acidic amino acid uptake porter, AatJMQP (characterized)
to candidate 16032 b1918 predicted transporter subunit: membrane component of ABC superfamily (NCBI)
Query= TCDB::Q88NY3 (248 letters) >FitnessBrowser__Keio:16032 Length = 222 Score = 114 bits (285), Expect = 2e-30 Identities = 70/216 (32%), Positives = 116/216 (53%), Gaps = 13/216 (6%) Query: 22 LDWYITGLGWTIAIAITAWIIALLLGSLLGVMRTVPNRLVSGIATAYVELFRNVPLLVQL 81 L + + G G+T+ ++I LLLG +L +MR P V +A Y+ +FR PL+ QL Sbjct: 12 LPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYISIFRGTPLIAQL 71 Query: 82 FIWYFLVPDLLPEGLQEWFKQDLNPTTSALISVVICLGLFTAARVCEQVRTGIQALPKGQ 141 F+ Y+ +P F +L+P SA+I L L TAA E +R I ++ KGQ Sbjct: 72 FMIYYGLPQ---------FGIELDPIPSAMIG----LSLNTAAYAAETLRAAISSIDKGQ 118 Query: 142 EAAARAMGFSLPQIYNNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQT 201 AA ++G + Q +LPQA R+ +PPL++ F+++ K++S+A+ I + EL Q + Sbjct: 119 WEAAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLI 178 Query: 202 AEFSANLFEAFTLATLIYFTLNMGLMLLMRMVEKKV 237 + +F + A+LIY+ + L L E ++ Sbjct: 179 TSRTLEVFTMYLAASLIYWIMATVLSTLQNHFENQL 214 Lambda K H 0.325 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 222 Length adjustment: 23 Effective length of query: 225 Effective length of database: 199 Effective search space: 44775 Effective search space used: 44775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory