Align 2-ketogluconate 6-phosphate reductase (EC 1.1.1.43) (characterized)
to candidate 16427 b2320 erythronate-4-phosphate dehydrogenase (NCBI)
Query= reanno::BFirm:BPHYT_RS11290 (321 letters) >FitnessBrowser__Keio:16427 Length = 378 Score = 82.8 bits (203), Expect = 1e-20 Identities = 84/259 (32%), Positives = 117/259 (45%), Gaps = 35/259 (13%) Query: 36 VAALKDADGGIGSSV-KITPAMLEGATRLKALSTISVGFDQFDVADLTRRGIVLANTPDV 94 VA L DAD + SV K+ ++L G +K + T + G D D A L + GI + P Sbjct: 32 VAQLADADALMVRSVTKVNESLLAGKP-IKFVGTATAGTDHVDEAWLKQAGIGFSAAPGC 90 Query: 95 LTESTADTVFSLILASARRVVELAEWVKAGHWQHSIGPALFGVDVQGKTLGIVGLGRIGG 154 + + VFS +L A R G + +T+GIVG+G +G Sbjct: 91 NAIAVVEYVFSSLLMLAERD---------------------GFSLYDRTVGIVGVGNVGR 129 Query: 155 AV-ARRAALGFNMKVLYTNRSANPQAEEAYGARRVELAELLATADFVCLQVPLTPE---- 209 + AR ALG +K L + P+A+ L EL+ AD + PL + Sbjct: 130 RLQARLEALG--IKTLLCDP---PRADRGDEGDFRSLDELVQRADILTFHTPLFKDGPYK 184 Query: 210 TKHLIGAAELKSMKKSAILINASRGATVDEKALIEALQNGTIHGAGLDVFETEPLPSDSP 269 T HL ++S+K AILINA RGA VD AL+ L G LDV+E EP + Sbjct: 185 TLHLADEKLIRSLKPGAILINACRGAVVDNTALLTCLNEGQKLSVVLDVWEGEP-ELNVE 243 Query: 270 LLKLANVVALPHIGSATHE 288 LLK + + HI T E Sbjct: 244 LLKKVD-IGTSHIAGYTLE 261 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 321 Length of database: 378 Length adjustment: 29 Effective length of query: 292 Effective length of database: 349 Effective search space: 101908 Effective search space used: 101908 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory