Align The pmf-dependent citrate uptake system, Cit1 (characterized)
to candidate 17139 b3063 predicted tartrate:succinate antiporter (NCBI)
Query= TCDB::Q6D017 (484 letters) >FitnessBrowser__Keio:17139 Length = 487 Score = 286 bits (732), Expect = 1e-81 Identities = 164/485 (33%), Positives = 257/485 (52%), Gaps = 20/485 (4%) Query: 11 WLAMIVILVIAAFFWQMEPPAGLNPAAWHSAVIFVATIVCIVANVLPIGAIGIISITLFA 70 W + L + A + PAGL W +F IV ++ +P + ++ I++ A Sbjct: 7 WWRYLAPLAVIAIIALLPVPAGLENHTWLYFAVFTGVIVGLILEPVPGAVVAMVGISIIA 66 Query: 71 LTYA-----------AGDKTASGAIQTALSDLNSSLIWLIVVAFMIARGFIKTGLGRRIA 119 + G K + ++ A+S ++S+IWLI AFM G+ KTGLGRRIA Sbjct: 67 ILSPWLLFSPEQLAQPGFKFTAKSLSWAVSGFSNSVIWLIFAAFMFGTGYEKTGLGRRIA 126 Query: 120 LQMIRLLGKRTLGLAYGLAFADLVLSPAMPSNTARCGGIIYPIADSLSRSFDSKPEDASR 179 L +++ +G RTL L Y + F++L+L+P PSN+AR GIIYPI +L + S+P D+S Sbjct: 127 LILVKKMGHRTLFLGYAVMFSELILAPVTPSNSARGAGIIYPIIRNLPPLYQSQPNDSSS 186 Query: 180 SKIGTFLITCIGNVND-VTAAMFMTAYTGNLLAVKLAANAG-VTITWGSWFLAALVPCLI 237 IG++ I +G V D VT+A+F+TA NLL + L +A T++WG WFL L ++ Sbjct: 187 RSIGSY-IMWMGIVADCVTSAIFLTAMAPNLLLIGLMKSASHATLSWGDWFLGMLPLSIL 245 Query: 238 SLAIVPLLVYWLTKPEIRHTPDAPKLAVAELAKMGSISRGEWLMAFTVILLLVLWIFGDR 297 + +VP L Y L P ++ P+ A EL MG + E M ++ LVLWIFG Sbjct: 246 LVLLVPWLAYVLYPPVLKSGDQVPRWAETELQAMGPLCSREKRMLGLMVGALVLWIFGGD 305 Query: 298 LGVDATTASFVGLSFLLLTGVLSWEDVKNEKGAWDTLIWFAALLMMANQLKKLGFTNWFG 357 +DA + ++ +LL ++SW+D+ + K AW+ W A+L+ +A L GF +WFG Sbjct: 306 Y-IDAAMVGYSVVALMLLLRIISWDDIVSNKAAWNVFFWLASLITLATGLNNTGFISWFG 364 Query: 358 DLIGSNIGHLMQGTSWVLVLLLLNAAYFYTHYFFASGNAQIAALFAVFLGVGINL-NIPA 416 L+ + + G S +V++ L ++ YFFAS A +AL + + + + IP Sbjct: 365 KLLAGS----LSGYSPTMVMVALIVVFYLLRYFFASATAYTSALAPMMIAAALAMPEIPL 420 Query: 417 VPMAFMLAFTSSLYCSLTQYTHARGPILFGAGYVPTAVWWRTGFVVSLVNQAIFMGAGLL 476 M+ L LT Y PI +G+GY+PTA +WR G + L+ + + GLL Sbjct: 421 PVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTADYWRLGAIFGLIFLVLLVITGLL 480 Query: 477 WWKAI 481 W + Sbjct: 481 WMPVV 485 Lambda K H 0.327 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 904 Number of extensions: 59 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 487 Length adjustment: 34 Effective length of query: 450 Effective length of database: 453 Effective search space: 203850 Effective search space used: 203850 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory