Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate 15830 b1711 vtamin B12-transporter permease (NCBI)
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__Keio:15830 Length = 326 Score = 174 bits (442), Expect = 2e-48 Identities = 113/290 (38%), Positives = 160/290 (55%), Gaps = 17/290 (5%) Query: 36 DWQAGHEHYYVLMEYRLPRLLLALFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLA 95 DW +V + RLPR L L VGAALA++G ++Q + NPLA P +LGV++ A + Sbjct: 42 DWFTPRGELFV-WQIRLPRTLAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVG 100 Query: 96 SVGALLL-MPSLPVMVLPLLAFAGGMAGLILLKMLAKTH-QPMKLALTGVALSA-CWASL 152 + A+LL LP L L A AG + ++L A+ H +L L GVAL C A + Sbjct: 101 LIAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALM 160 Query: 153 TDYLMLSRPQDVNNALLWLTGSLWGRDWSFVKIAIPLMILFLPLSLSFC---RDLDLLAL 209 T + S D+ + W+ G G DW LM+ +P+ L C R +++LAL Sbjct: 161 TWAIYFSTSVDLRQLMYWMMGGFGGVDWR----QSWLMLALIPVLLWICCQSRPMNMLAL 216 Query: 210 GDARATTLGVSVPHTRFWALLLAVA---MTSTGVAACGPISFIGLVVPHMMRSITGGRHR 266 G+ A LG+ + FW +L A M VA G I FIGLV+PH++R HR Sbjct: 217 GEISARQLGLPL---WFWRNVLVAATGWMVGVSVALAGAIGFIGLVIPHILRLCGLTDHR 273 Query: 267 RLLPVSALTGALLLVVADLLARIIHPPLELPVGVLTAIIGAPWFVWLLVR 316 LLP AL GA L++AD++AR+ ELP+GV+TA +GAP F+WLL++ Sbjct: 274 VLLPGCALAGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLK 323 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 326 Length adjustment: 28 Effective length of query: 290 Effective length of database: 298 Effective search space: 86420 Effective search space used: 86420 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory