Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate 15918 b1800 predicted dehydrogenase (NCBI)
Query= BRENDA::Q5SIJ1 (334 letters) >FitnessBrowser__Keio:15918 Length = 361 Score = 221 bits (563), Expect = 2e-62 Identities = 138/355 (38%), Positives = 201/355 (56%), Gaps = 28/355 (7%) Query: 4 RICLIEGDGIGHEVIPAARRVLEAT----GLPLEFVEAE-AGWETFERRGTSVPEETVEK 58 RI I GDGIG EV+P RVL+A G L F + E A E + G +P++ E+ Sbjct: 6 RIAAIPGDGIGKEVLPEGIRVLQAAAERWGFALSFEQMEWASCEYYSHHGKMMPDDWHEQ 65 Query: 59 ILSCHATLFGAATSPTRKVP---GFFGAIRYLRRRLDLYANVRPAK-----SRPVPGSRP 110 + A FGA P VP +G++ RR D Y N+RP + P+ G +P Sbjct: 66 LSRFDAIYFGAVGWPDT-VPDHISLWGSLLKFRREFDQYVNLRPVRLFPGVPCPLAGKQP 124 Query: 111 G-VDLVIVRENTEGLYVE-----QERRYLDVAIADAVISKKASERIGRAALRIAEGRPRK 164 G +D +VRENTEG Y E +V I ++V +++ +RI R A +A+ RPRK Sbjct: 125 GDIDFYVVRENTEGEYSSLGGRVNEGTEHEVVIQESVFTRRGVDRILRYAFELAQSRPRK 184 Query: 165 TLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIVTTN 224 TL A K+N L ++ + + V+ +A+++P + +D + VM+PERFDV+V +N Sbjct: 185 TLTSATKSNGLAISMPYWDERVEAMAENYPEIRWDKQHIDILCARFVMQPERFDVVVASN 244 Query: 225 LLGDILSDLAAGLVGGLGLAPSGNIGDT---TAVFEPVHGSAPDIAGKGIANPTAAILSA 281 L GDILSDL G +G+APS N+ ++FEPVHGSAPDI GK IANP A I + Sbjct: 245 LFGDILSDLGPACTGTIGIAPSANLNPERTFPSLFEPVHGSAPDIYGKNIANPIATIWAG 304 Query: 282 AMMLDYLGE-----KEAAKRVEKAVDLVLERGPRTPDLGGDATTEAFTEAVVEAL 331 AMMLD+LG ++A + A++ V+ GP+TPD+ G+ATT +A+ + + Sbjct: 305 AMMLDFLGNGDERFQQAHNGILAAIEEVIAHGPKTPDMKGNATTPQVADAICKII 359 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 310 Number of extensions: 15 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 361 Length adjustment: 29 Effective length of query: 305 Effective length of database: 332 Effective search space: 101260 Effective search space used: 101260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory