Align Succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate 15422 b1302 GABA aminotransferase, PLP-dependent (NCBI)
Query= reanno::pseudo1_N1B4:Pf1N1B4_3440 (406 letters) >FitnessBrowser__Keio:15422 Length = 421 Score = 204 bits (518), Expect = 5e-57 Identities = 137/383 (35%), Positives = 192/383 (50%), Gaps = 33/383 (8%) Query: 38 DQSGRELIDFAGGIAVNVLGHAHPALVAALTEQANKLWHVS-NVFTNEPALRLAHK---L 93 D G E IDFA GIAV GH HP LVAA+ +Q + H + + E + LA K L Sbjct: 36 DVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINAL 95 Query: 94 VDATFAERVFFCNSGAEANEAAFKLARRVAHDRFGTEKYEIVAALNSFHGRTLFTVNVGG 153 + + F +GAEA E A K+AR AH T + ++A FHGRT T+ + G Sbjct: 96 APVSGQAKTAFFTTGAEAVENAVKIAR--AH----TGRPGVIAFSGGFHGRTYMTMALTG 149 Query: 154 Q-SKYSDGFGPKITGITHVPY-NDLAALKAAVS--------------DKTCAVVLEPIQG 197 + + Y GFGP + HVPY +DL + S + A++ EP+QG Sbjct: 150 KVAPYKIGFGPFPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAIIFEPVQG 209 Query: 198 EGGVLPAELSYLQGARELCDAHNALLVFDEVQTGMGRSGKLFAYQHYGVTPDILTSAKSL 257 EGG A + R LCD H +++ DEVQ+G R+GKLFA HY PD++T AKSL Sbjct: 210 EGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLMTMAKSL 269 Query: 258 GGGFPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEAVIDVINTPEVLNGVNAKHDK 317 GG P++ ++ ++ G G TY GNPLA A A AV+++I+ + N + Sbjct: 270 AGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERANQLGQR 329 Query: 318 FKTRLEQIGEKYGLFTEVRGLGLLLGCVLSDAWKGK-----AKDIFNAAEREGLMILQAG 372 K L E VRGLG ++ +D G+ A+ I A +GL++L G Sbjct: 330 LKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGLLLLTCG 389 Query: 373 P--DVIRFAPSLVVEDADIDAGL 393 +VIRF L + DA DA + Sbjct: 390 AYGNVIRFLYPLTIPDAQFDAAM 412 Lambda K H 0.320 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 433 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 421 Length adjustment: 31 Effective length of query: 375 Effective length of database: 390 Effective search space: 146250 Effective search space used: 146250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory