GapMind for catabolism of small carbon sources


Aligments for a candidate for patD in Escherichia coli BW25113

Align aminobutyraldehyde dehydrogenase (EC (characterized)
to candidate 15565 b1444 medium chain aldehyde dehydrogenase (NCBI)

Query= BRENDA::P77674
         (474 letters)

>lcl|FitnessBrowser__Keio:15565 b1444 medium chain aldehyde
           dehydrogenase (NCBI)
          Length = 474

 Score =  949 bits (2454), Expect = 0.0
 Identities = 474/474 (100%), Positives = 474/474 (100%)









Lambda     K      H
   0.317    0.134    0.397 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 894
Number of extensions: 28
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 474
Length of database: 474
Length adjustment: 33
Effective length of query: 441
Effective length of database: 441
Effective search space:   194481
Effective search space used:   194481
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate 15565 b1444 (medium chain aldehyde dehydrogenase (NCBI))
to HMM TIGR03374 (ydcW: 1-pyrroline dehydrogenase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03374.hmm
# target sequence database:        /tmp/gapView.19152.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03374  [M=472]
Accession:   TIGR03374
Description: ABALDH: 1-pyrroline dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
          0 1033.1   0.9          0 1032.9   0.9    1.0  1  lcl|FitnessBrowser__Keio:15565  b1444 medium chain aldehyde dehy

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Keio:15565  b1444 medium chain aldehyde dehydrogenase (NCBI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ! 1032.9   0.9         0         0       1     472 []       2     473 ..       2     473 .. 1.00

  Alignments for each domain:
  == domain 1  score: 1032.9 bits;  conditional E-value: 0
                       TIGR03374   1 qdklliegklvagegekqavynpatgevileiaeasaeqvdaavraadaafaewgqttpkaraelllkladaieenaev 79 
                                     q+klli+g+lv+gegekq+vynpatg+v+leiaeasaeqvdaavraadaafaewgqttpk rae+llklad+ieen++v
                                     79***************************************************************************** PP

                       TIGR03374  80 faklesrncgkplhavlndeipaivdvfrffagaarclsglaageyleghtsmirrdpvgvvasiapwnyplmmaawkl 158
                                     ******************************************************************************* PP

                       TIGR03374 159 apalaagncvvlkpseitpltalklaelakdilpagvvnvlfgrgktvgdaltghekvrmvsltgsiatgehilahtaa 237
                                     ******************************************************************************* PP

                       TIGR03374 238 sikrthmelggkapvivfddadidavvegvrtfgfynagqdctaacriyaqrgiydelveklgkavatlkigapedest 316
                                     ******************************************************************************* PP

                       TIGR03374 317 elgplsslahlervsaaveeakalshikvitggekvkgkgyyfaptllagakqddaivqkevfgpvvsitvfddeeqvv 395
                                     elgplsslahlerv +aveeaka++hikvitggek+kg+gyy+aptllaga+qddaivqkevfgpvvs+t fd+eeqvv
                                     ******************************************************************************* PP

                       TIGR03374 396 rwandsryglassvwtkdvgrahrlsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhimvk 472
                                     ***************************************************************************98 PP

Internal pipeline statistics summary:
Query model(s):                            1  (472 nodes)
Target sequences:                          1  (474 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.03
# Mc/sec: 7.41

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory