GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Escherichia coli BW25113

Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate 17247 b3176 phosphoglucosamine mutase (NCBI)

Query= BRENDA::Q6I7B6
         (450 letters)



>lcl|FitnessBrowser__Keio:17247 b3176 phosphoglucosamine mutase
           (NCBI)
          Length = 445

 Score =  140 bits (354), Expect = 6e-38
 Identities = 131/455 (28%), Positives = 210/455 (46%), Gaps = 51/455 (11%)

Query: 2   RLFGTAGIRGTLWEK-VTPELAMKVGMAVGT----YKSGKALVGRDGRTSSVMLKNAMIS 56
           + FGT GIRG + +  +TP+  +K+G A G     + S K ++G+D R S  ML++A+ +
Sbjct: 5   KYFGTDGIRGRVGDAPITPDFVLKLGWAAGKVLARHGSRKIIIGKDTRISGYMLESALEA 64

Query: 57  GLLSTGMEVLDADLIPTPALAWGTRKL-ADAGVMITASHNPPTDNGVKVFNGDGTEFYVE 115
           GL + G+  L    +PTPA+A+ TR   A+AG++I+ASHNP  DNG+K F+ DGT+    
Sbjct: 65  GLAAAGLSALFTGPMPTPAVAYLTRTFRAEAGIVISASHNPFYDNGIKFFSIDGTKLPDA 124

Query: 116 QERGLEEIIFSGNFRKARWDEIKPVRNVEVIPDYINAVLDFVGHE---TNLKVLYDGANG 172
            E  +E  +          +  K  R V+    YI        +E   + LK++ D ANG
Sbjct: 125 VEEAIEAEMEKEISCVDSAELGKASRIVDAAGRYIEFCKATFPNELSLSELKIVVDCANG 184

Query: 173 AGSLVAPYLLREMGAKVLSVNAHVDGHFPGRKPEPRYENIAYLGKLVRELGVDLAIAQDG 232
           A   +AP +LRE+GA V+++    +G       E    ++  L   V     DL IA DG
Sbjct: 185 ATYHIAPNVLRELGANVIAIGCEPNG--VNINAEVGATDVRALQARVLAEKADLGIAFDG 242

Query: 233 DADRIAVFDEKGNYVDEDTVIALFAKLYVEE---HGGGTVVVSIDTGSRIDAVVERAGGR 289
           D DR+ + D +GN VD D ++ + A+  + +    GG    +  + G  ++  +++ G  
Sbjct: 243 DGDRVIMVDHEGNKVDGDQIMYIIAREGLRQGQLRGGAVGTLMSNMG--LELALKQLG-- 298

Query: 290 VVRIPLGQPHDGIKRYKAIFAAEPWKLVHPKFGPWI--DPFVT-------MGLLIKLIDE 340
              IP  +   G +        + W++     G  I  D   T       + +L  +   
Sbjct: 299 ---IPFARAKVGDRYVLEKMQEKGWRIGAENSGHVILLDKTTTGDGIVAGLQVLAAMARN 355

Query: 341 NGPLSELVKEIPTYYLKKANVL----CPDEYKAEVVRRAAEEVERKLSSEIKEVLTISGF 396
           +  L +L   +  +     NV       D  + E V+    EVE                
Sbjct: 356 HMSLHDLCSGMKMFPQILVNVRYTAGSGDPLEHESVKAVTAEVE---------------- 399

Query: 397 RIALNDGSWILIRPSGTEPKIRVVAEAPTEKRRDE 431
             AL +   +L+R SGTEP IRV+ E   E +  E
Sbjct: 400 -AALGNRGRVLLRKSGTEPLIRVMVEGEDEAQVTE 433


Lambda     K      H
   0.318    0.138    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 456
Number of extensions: 27
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 450
Length of database: 445
Length adjustment: 33
Effective length of query: 417
Effective length of database: 412
Effective search space:   171804
Effective search space used:   171804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory