GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Escherichia coli BW25113

Align Phosphopentomutase; EC 5.4.2.7; Phosphodeoxyribomutase (uncharacterized)
to candidate 17443 b3380 predicted mutase (NCBI)

Query= curated2:Q67ND8
         (393 letters)



>lcl|FitnessBrowser__Keio:17443 b3380 predicted mutase (NCBI)
          Length = 408

 Score =  134 bits (338), Expect = 4e-36
 Identities = 122/423 (28%), Positives = 189/423 (44%), Gaps = 59/423 (13%)

Query: 6   RVVLIVIDSVGIGAMPDAA--DWGDAGANTLGNMARQRGGLPLPNLGRLGLGNLCAIEGT 63
           R V++VIDS G+GAM D       DAGANT G++  Q   L LP L  LGL N       
Sbjct: 3   RFVVLVIDSFGVGAMKDVTLVRPQDAGANTCGHILSQLPHLQLPTLETLGLINALGYAPG 62

Query: 64  PPVDAPAGAYGRMAIFSHGKDTMTGHWEMVGIRP----EAPFRTYPDGFPEDLIA---EF 116
               + +  +G   +   G DT  GH E++G RP      PFR   D   + L++   + 
Sbjct: 63  DMQPSDSATWGVAELQHEGGDTFMGHQEILGTRPLPPLRMPFRDVIDRVEQALVSAGWQV 122

Query: 117 CRRAG-LEGVLGNK-VASGTEIIKELGEEHLRTGWPIVYTSADSVFQVAAHEERFGLERL 174
            RR   L+ +  N+ VA G  +  +LG+                V+ + A+      +  
Sbjct: 123 ERRGDDLQFLWVNQAVAIGDNLEADLGQ----------------VYNITANLSVISFDDA 166

Query: 175 YEVCRIARDLLRPPHRVGRVIARPFVGTDRTNFTRTANRHD------------------- 215
            ++ RI R+ ++    VGRVI    + TD       A   +                   
Sbjct: 167 IKIGRIVREQVQ----VGRVITFGGLLTDSQRILDAAESKEGRFIGINAPRSGAYDNGFQ 222

Query: 216 -----YALEPPRMLLDEVKDAGLSVLAVGKISDIFSG-HGITYSVHTKSNADGIEKIHEC 269
                Y ++    +  ++ +AG+  + VGK++DI +  +G+++     S       ++E 
Sbjct: 223 VVHMGYGVDEKVQVPQKLYEAGVPTVLVGKVADIVNNPYGVSWQNLVDSQRIMDITLNE- 281

Query: 270 LDRQEPGLIFANLVDFDMLYGHRRDVEGYARAMLEFDAALPAIMAKLGPEDVLVVTADHG 329
            +      I  N+ + D L GH  DV  YA  +   D  L  ++  + P+D LVV ADHG
Sbjct: 282 FNTHPTAFICTNIQETD-LAGHAEDVARYAERLQVVDRNLARLVEAMQPDDCLVVMADHG 340

Query: 330 NDPTYIGTDHTREYVPVLLYGEPIKPGVDVGTRASLADLGATVADLLGVPQTGFGESFAD 389
           NDPT   + HTRE VPVL+Y + +     +G R +L+D+GATV +    P    G SF  
Sbjct: 341 NDPTIGHSHHTREVVPVLVYQQGM-IATQLGVRTTLSDVGATVCEFFRAPPPQNGRSFLS 399

Query: 390 QIR 392
            +R
Sbjct: 400 SLR 402


Lambda     K      H
   0.321    0.141    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 409
Number of extensions: 25
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 393
Length of database: 408
Length adjustment: 31
Effective length of query: 362
Effective length of database: 377
Effective search space:   136474
Effective search space used:   136474
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory