Align purine nucleoside phosphorylase; EC 2.4.2.1 (characterized)
to candidate 17879 b3831 uridine phosphorylase (NCBI)
Query= CharProtDB::CH_023932 (247 letters) >FitnessBrowser__Keio:17879 Length = 253 Score = 112 bits (281), Expect = 5e-30 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 3/157 (1%) Query: 9 HIRLRKEDVE--PVVIIVGDPARTEEVANMCEKKQELAYNREYRSFRVVYDSQPITVISH 66 H+ L K D++ + I+ GDP R E++A + +K +LA +RE+ ++R D +P+ V S Sbjct: 8 HLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCST 67 Query: 67 GIGCPGTSIAIEELAYLGAKVIIRAGTCGSLKPKTLKQGDVCVTYAAVNETGLISNILPE 126 GIG P TSIA+EELA LG + +R GT G+++P + GDV VT A+V G + P Sbjct: 68 GIGGPSTSIAVEELAQLGIRTFLRIGTTGAIQPH-INVGDVLVTTASVRLDGASLHFAPL 126 Query: 127 GFPCVATPHVYQALMDAAKELGIEAASGIGVTQDYFY 163 FP VA AL++AAK +G G+ + D FY Sbjct: 127 EFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFY 163 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 253 Length adjustment: 24 Effective length of query: 223 Effective length of database: 229 Effective search space: 51067 Effective search space used: 51067 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory