Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate 18274 b4249 predicted oxidoreductase with NAD(P)-binding Rossmann-fold domain (NCBI)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Keio:18274 Length = 237 Score = 86.7 bits (213), Expect = 4e-22 Identities = 73/248 (29%), Positives = 118/248 (47%), Gaps = 21/248 (8%) Query: 12 GLRVLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGVADVSDCAQ 71 G VLI G + GIGAAI + F+ GANV + D A+ + A A +D A Sbjct: 6 GKTVLILGGSRGIGAAIVRRFVTDGANVRFTYA--GSKDAAKRLAQETGA-TAVFTDSAD 62 Query: 72 VDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPL 131 D +ID R K G LD+L+ NAGI G G +L+ + +R N+++ ++ +V Sbjct: 63 RDAVIDVVR-KSGALDILVVNAGI-GVFGEALELNADDIDRLFKINIHAPYH---ASVEA 117 Query: 132 LKETSANPGIIAMASVAG-RLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAILPG 190 ++ I+ + SV G R+ A YAASK A+ GM + LA + GP + +N + PG Sbjct: 118 ARQMPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPG 177 Query: 191 VVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNIS 250 ++ + M+ ++++R +VA M +LA P ++ Sbjct: 178 PIDTD------------ANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVT 225 Query: 251 GQAISVDG 258 G ++DG Sbjct: 226 GAMHTIDG 233 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 237 Length adjustment: 24 Effective length of query: 239 Effective length of database: 213 Effective search space: 50907 Effective search space used: 50907 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory