GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fruI in Escherichia coli BW25113

Align Phosphoenolpyruvate--protein phosphotransferase (EC 2.7.3.9) (characterized)
to candidate 16910 b2829 fused PTS enzyme: PEP-protein phosphotransferase (enzyme I)/GAF domain containing protein (NCBI)

Query= reanno::pseudo5_N2C3_1:AO356_07335
         (954 letters)



>lcl|FitnessBrowser__Keio:16910 b2829 fused PTS enzyme: PEP-protein
           phosphotransferase (enzyme I)/GAF domain containing
           protein (NCBI)
          Length = 748

 Score =  351 bits (900), Expect = e-100
 Identities = 222/566 (39%), Positives = 325/566 (57%), Gaps = 18/566 (3%)

Query: 403 IQAVAAAPGIAIGP----AHIQVLQAIDYPLRGESAAIERERLQNALNQVRSDIQGLIER 458
           I+A+ AAPG+AI      A + +++ + Y       A+ERERL  AL +  ++ +   +R
Sbjct: 171 IRALPAAPGVAIAEGWQDATLPLMEQV-YQASTLDPALERERLTGALEEAANEFRRYSKR 229

Query: 459 AKAKAIRE---IFITHQEMLDDPELTDEVDTRLKLGESAQAAWMGVIEAAAKEQEALQDA 515
             A A +E   IF  +  +L D  L  E+   +  G  A+ A   VIE  A++  AL D 
Sbjct: 230 FAAGAQKETAAIFDLYSHLLSDTRLRRELFAEVDKGSVAEWAVKTVIEKFAEQFAALSDN 289

Query: 516 LLAERAADLRDVGRRVLAQLCGV-ETPNEPDQPYILVMDEVGPSDVARLDPTRVAGILTA 574
            L ERA DLR +G+R+L  L    + PN   + +ILV DE+  + +A L   R+ G++  
Sbjct: 290 YLKERAGDLRALGQRLLFHLDDANQGPNAWPERFILVADELSATTLAELPQDRLVGVVVR 349

Query: 575 RGGATAHSAIVARALGIPALVGAGAAVLLLAPGTSLLLDGQRGRLHVDPDAATLQRAKEE 634
            G A +H+AI+ RALGIP ++GA     +L   T L++DG RG L VDP+   LQ  +  
Sbjct: 350 DGAANSHAAIMVRALGIPTVMGADIQPSVLHRRT-LIVDGYRGELLVDPEPVLLQEYQRL 408

Query: 635 RDTREQRLKVAAEQRHEPALTRDGHAVEVFANIGESAGVASAVEQGAEGIGLLRTELIFM 694
                +  ++A +  + PA  + G  ++V  N G S      +    +GIGL RTE+ FM
Sbjct: 409 ISEEIELSRLAEDDVNLPAQLKSGERIKVMLNAGLSPEHEEKLGSRIDGIGLYRTEIPFM 468

Query: 695 AHSQAPDEATQEAEYRKVLDGLAGRPLVVRTLDVGGDKPLPYWPIAKEENPFLGVRGIRL 754
             S  P E  Q A+Y+ +L     +P+ +RTLDVG DK LPY PI+ EENP LG RGIR+
Sbjct: 469 LQSGFPSEEEQVAQYQGMLQMFNDKPVTLRTLDVGADKQLPYMPIS-EENPCLGWRGIRI 527

Query: 755 TLQRPQVMEAQLRALLRS-ADSRPLRIMFPMVGSVDEWRQARAMTERLRLEIP------V 807
           TL +P++   Q+RA+LR+ A +  L I+ PMV S+DE  +AR + ER   E+       +
Sbjct: 528 TLDQPEIFLIQVRAMLRANAATGNLNILLPMVTSLDEVDEARRLIERAGREVEEMIGYEI 587

Query: 808 ADLQLGIMIEVPSAALLAPVLAKEVDFFSVGTNDLTQYTLAIDRGHPTLSAQADGLHPAV 867
              ++GIM+EVPS   + P LAK VDF SVGTNDLTQY LA+DR +  ++   D LHPA+
Sbjct: 588 PKPRIGIMLEVPSMVFMLPHLAKRVDFISVGTNDLTQYILAVDRNNTRVANIYDSLHPAM 647

Query: 868 LQLIDITVRAAHAHGKWVGVCGELAADPLAVPVLVGLGVDELSVSARSIAEVKARVRELS 927
           L+ + +  R A  HG  + +CGE+A DP+ V +L+GLG   LS++ RS+A  K  +R + 
Sbjct: 648 LRALAMIAREAEIHGIDLRLCGEMAGDPMCVAILIGLGYRHLSMNGRSVARAKYLLRRID 707

Query: 928 LAQVQTLAQAALAVGSADDVRALVEA 953
            A+ + LAQ +L    A +VR  V A
Sbjct: 708 YAEAENLAQRSLEAQLATEVRHQVAA 733


Lambda     K      H
   0.318    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1209
Number of extensions: 55
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 954
Length of database: 748
Length adjustment: 42
Effective length of query: 912
Effective length of database: 706
Effective search space:   643872
Effective search space used:   643872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory