Align PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 (characterized)
to candidate 15935 b1817 fused mannose-specific PTS enzymes: IIA component/IIB component (NCBI)
Query= SwissProt::P26380 (163 letters) >FitnessBrowser__Keio:15935 Length = 323 Score = 157 bits (398), Expect = 1e-43 Identities = 77/162 (47%), Positives = 110/162 (67%) Query: 2 MNIVLARIDDRFIHGQILTRWIKVHAADRIIVVSDDIAQDEMRKTLILSVAPSNVKASAV 61 M I LARIDDR IHGQ+ TRW K RIIVVSD++A D +RKTL+ VAP V A V Sbjct: 162 MVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVV 221 Query: 62 SVSKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENHRRQITKSV 121 V+KM + +++P+Y G MLLF NP+D+ L+E GV I +VNVGGM F + Q+ +V Sbjct: 222 DVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAV 281 Query: 122 SVTEQDIKAFETLSDKGVKLELRQLPSDASEDFVQILRNVTK 163 SV E+DI+AF+ L+ +G++LE+R++ +D + ++ + K Sbjct: 282 SVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK 323 Lambda K H 0.320 0.133 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 323 Length adjustment: 23 Effective length of query: 140 Effective length of database: 300 Effective search space: 42000 Effective search space used: 42000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory