Align Fructokinase; EC 2.7.1.4 (characterized)
to candidate 17923 b3883 putative kinase (VIMSS)
Query= SwissProt::P26420 (307 letters) >FitnessBrowser__Keio:17923 Length = 298 Score = 93.6 bits (231), Expect = 5e-24 Identities = 90/300 (30%), Positives = 122/300 (40%), Gaps = 28/300 (9%) Query: 13 VDLLPDGEGRLL-----QCPGGAPANVAVGVARLGGDSGFIGRVGDDPFGRFMRHTLAQE 67 V+ LP G+ + + GG A AV ARLG FIGRVGDD G + L Sbjct: 18 VEGLPTESGKYVARNYTEVGGGPAATAAVAAARLGAQVDFIGRVGDDDTGNSLLAELESW 77 Query: 68 QVDVNYMRLDAAQRTSTVVVDLDSHGERTFTFMVRPSADLFLQPEDLPPFAAGQWLHVCS 127 V+ Y + ++S + +D+ GER + PS DL E L QW Sbjct: 78 GVNTRYTKRYNQAKSSQSAIMVDTKGER--IIINYPSPDLLPDAEWLEEIDFSQW----D 131 Query: 128 IALSAEPSRSTTFAALEAIKRAGGYVSFDPNIRSDLWQDPQDLRDCLDRALALADAIKLS 187 + L+ A ++AG D +I PQD+ + +AL+D S Sbjct: 132 VVLADVRWHDGAKKAFTLARQAGVMTVLDGDI------TPQDISE----LVALSDHAAFS 181 Query: 188 EEELAFISGSDDIVSGIARLNARFQPTLLLVTQGKAGVQAALRGQVSHFPARPVVAVDTT 247 E LA ++G ++ S + + + VTQG AG G H PA V VDTT Sbjct: 182 EPGLARLTGVKEMASALKQAQT-LTNGHVYVTQGSAGCDWLENGGRQHQPAFKVDVVDTT 240 Query: 248 GAGDAFVAGLLAGLAAHGIPDNLAALAPDLALAQTCGALATTAKGAMTALPYKDDLQRSL 307 GAGD F L LA G LA + A AL T G +P D + L Sbjct: 241 GAGDVFHGALAVALATSG------DLAESVRFASGVAALKCTRPGGRAGIPDCDQTRSFL 294 Lambda K H 0.321 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 298 Length adjustment: 27 Effective length of query: 280 Effective length of database: 271 Effective search space: 75880 Effective search space used: 75880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory