Align ABC transporter for L-Fucose, permease component 2 (characterized)
to candidate 18060 b4032 maltose transporter subunit (NCBI)
Query= reanno::Smeli:SM_b21105 (288 letters) >FitnessBrowser__Keio:18060 Length = 296 Score = 130 bits (328), Expect = 3e-35 Identities = 95/289 (32%), Positives = 140/289 (48%), Gaps = 19/289 (6%) Query: 14 LKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLSLDAYRAM--FSGA 71 L + HL L L + I P L +V SLR IPE +S D ++ FS Sbjct: 13 LFITHLL-LLLFIAAIMFPLLMVVAISLRQGNFATGS---LIPEQISWDHWKLALGFSVE 68 Query: 72 GQGG------VPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFLGFMLT 125 G PV + NS+ V+ S + +A+ + YAFAR RF K+ + G ++ Sbjct: 69 QADGRITPPPFPVLLWLWNSVKVAGISAIGIVALSTTCAYAFARMRFPGKATLLKGMLIF 128 Query: 126 RAVPGIALSLPLFMLYARTGI------IDTHFSLILTYVALNVPFTIWLIDGFFRQVPKD 179 + P + + L+ L+ R G ++TH +I Y+ + +W I G+F + Sbjct: 129 QMFPAVLSLVALYALFDRLGEYIPFIGLNTHGGVIFAYLG-GIALHVWTIKGYFETIDSS 187 Query: 180 LAEAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPV 239 L EAA +DG TPWQAF V PL+ P +A I +F+ + E +AS + R VNS TL V Sbjct: 188 LEEAAALDGATPWQAFRLVLLPLSVPILAVVFILSFIAAITEVPVASLLLRDVNSYTLAV 247 Query: 240 GLLDYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG 288 G+ Y W A AV+ +P + + Q+ LV+GLT G VKG Sbjct: 248 GMQQYLNPQNYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTAGGVKG 296 Lambda K H 0.328 0.141 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 296 Length adjustment: 26 Effective length of query: 262 Effective length of database: 270 Effective search space: 70740 Effective search space used: 70740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory