Align L-fuculose-phosphate aldolase (EC 4.1.2.17) (characterized)
to candidate 16884 b2800 L-fuculose phosphate aldolase (NCBI)
Query= BRENDA::P0AB87 (215 letters) >FitnessBrowser__Keio:16884 Length = 215 Score = 433 bits (1114), Expect = e-126 Identities = 215/215 (100%), Positives = 215/215 (100%) Query: 1 MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG 60 MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG Sbjct: 1 MERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDG 60 Query: 61 NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG 120 NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG Sbjct: 61 NGKHEEGKLPSSEWRFHMAAYQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGG 120 Query: 121 NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL 180 NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL Sbjct: 121 NSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIACEVNLEKALWLAHEVEVLAQL 180 Query: 181 YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE 215 YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE Sbjct: 181 YLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE 215 Lambda K H 0.319 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 215 Length adjustment: 22 Effective length of query: 193 Effective length of database: 193 Effective search space: 37249 Effective search space used: 37249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate 16884 b2800 (L-fuculose phosphate aldolase (NCBI))
to HMM TIGR01086 (fucA: L-fuculose phosphate aldolase (EC 4.1.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01086.hmm # target sequence database: /tmp/gapView.23066.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01086 [M=214] Accession: TIGR01086 Description: fucA: L-fuculose phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-138 444.7 0.2 3e-138 444.6 0.2 1.0 1 lcl|FitnessBrowser__Keio:16884 b2800 L-fuculose phosphate aldol Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Keio:16884 b2800 L-fuculose phosphate aldolase (NCBI) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.6 0.2 3e-138 3e-138 1 214 [] 2 215 .] 2 215 .] 1.00 Alignments for each domain: == domain 1 score: 444.6 bits; conditional E-value: 3e-138 TIGR01086 1 nraelsqkiidtclemtrlglnqgtagnvsvrykdgmlitptgipyeklteehivyvdgngkfeegklpssewrfhlav 79 +r++l+++iidtclemtrlglnqgtagnvsvry+dgmlitptgipyeklte+hiv++dgngk+eegklpssewrfh+a+ lcl|FitnessBrowser__Keio:16884 2 ERNKLARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAA 80 79***************************************************************************** PP TIGR01086 80 yqsrpdanavvhnhaihcaavsilnksipaihymvaasgadeipcvpyatfgsrklaeyvaegikeskaillqhhglia 158 yqsrpdanavvhnha+hc+avsiln+sipaihym+aa+g+++ipc+pyatfg+r+l+e+va+++k++ka+llqhhglia lcl|FitnessBrowser__Keio:16884 81 YQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIA 159 ******************************************************************************* PP TIGR01086 159 cevnlekalwlahevevladlylktlaitdevpvlseeelavvlekfktyglriee 214 cevnlekalwlahevevla+lyl+tlaitd+vpvls+ee+avvlekfktyglriee lcl|FitnessBrowser__Keio:16884 160 CEVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTYGLRIEE 215 ******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (214 nodes) Target sequences: 1 (215 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.67 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory