Align L-fuculose kinase (characterized, see rationale)
to candidate 17944 b3904 rhamnulokinase (NCBI)
Query= uniprot:G8JZS7 (476 letters) >FitnessBrowser__Keio:17944 Length = 489 Score = 315 bits (806), Expect = 3e-90 Identities = 188/473 (39%), Positives = 262/473 (55%), Gaps = 11/473 (2%) Query: 4 TTRNTYLAVDFGGGSGRVIAGSLLQG--KLELEEIHRFTNRQVKLGNHVYWDFPALFEDM 61 T RN +AVD G SGRV+ + L L EIHRF N +V WD +L + Sbjct: 2 TFRNC-VAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDSLESAI 60 Query: 62 KTGLKLAAQKGYHVKGIGIDTWGVDFGLIDKKGNLLGNPVCYRDARTDGMPDKVFQILDA 121 + GL ++G + IGIDTWGVDF L+D++G +G PV YRD+RT+G+ + Q L Sbjct: 61 RLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQQQLGK 120 Query: 122 QKHYACTGIQVMPINTLFQLYSMQQNQDVLLEVAQRLLFMPDLFSYYLTGVANNEYCIAS 181 + Y +GIQ +P NTL+QL ++ + Q L+ L MPD FSY LTG N EY A+ Sbjct: 121 RDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWEYTNAT 180 Query: 182 TSELLDARQRNWSMDTIRALGLPEHLFGEIILPGTVRGTLKEEIGRETGLGPVDIIAVGS 241 T++L++ +W + G + FG PG V G G E + ++AV S Sbjct: 181 TTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGNE-----IPVVAVAS 235 Query: 242 HDTASAVAAVPATEGQVAFLSSGTWSLLGVEVDEPILTEEARLAQFTNEGGVGGHIRFLQ 301 HDTASAV A P + A+LSSGTWSL+G E P + A A TNEGG G R L+ Sbjct: 236 HDTASAVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGRYRVLK 295 Query: 302 NITGLWILQRLMSEWKLRGEEQSYDTILPQAADAEIDTIIPVDDAEFMNPENMETALLNY 361 NI GLW+LQR++ E ++ QA A I P DD F+NPE M + + Sbjct: 296 NIMGLWLLQRVLQEQQINDLPALISA--TQALPACRFIINPNDD-RFINPETMCSEIQAA 352 Query: 362 CRNHSLKVPGNKAEMVKCVLQSLAFKYREAVAQLNRCLPSPIHRLNIIGGGSQNKLLNQL 421 CR + +P + AE+ +C+ SLA Y + + +L + +L+I+GGG QN LLNQL Sbjct: 353 CRETAQPIPESDAELARCIFDSLALLYADVLHELAQLRGEDFSQLHIVGGGCQNTLLNQL 412 Query: 422 TANALGIPVYAGPVEATAMGNILTQAMAKGEISSLREIREVVSHSVTPQVYYP 474 A+A GI V AGPVEA+ +GNI Q M E++++ + R+VVS + + P Sbjct: 413 CADACGIRVIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTP 465 Lambda K H 0.319 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 567 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 489 Length adjustment: 34 Effective length of query: 442 Effective length of database: 455 Effective search space: 201110 Effective search space used: 201110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory